[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53194.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  426/915 : Eukaryota  67/199 : Viruses  0/175   --->[See Alignment]
d.79.1
:104 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->100 2dyyG PDBj 3e-15 35.7 %
:RPS:PDB   2->101 2dyyG PDBj 8e-22 35.7 %
:RPS:SCOP  2->100 1jd1A  d.79.1.1 * 2e-21 28.1 %
:HMM:SCOP  1->103 1nq3A_ d.79.1.1 * 1.9e-27 44.6 %
:RPS:PFM   1->101 PF01042 * Ribonuc_L-PSP 7e-11 40.0 %
:HMM:PFM   2->100 PF01042 * Ribonuc_L-PSP 1.5e-26 35.7 98/121  
:BLT:SWISS 3->100 Y1251_PYRAB 7e-16 36.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53194.1 GT:GENE BAF53194.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 246784..247098 GB:FROM 246784 GB:TO 247098 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53194.1 LENGTH 104 SQ:AASEQ MHISGMVAFDSDANIVGEGDIEAQTEQVFRNLQAVVEEAGGTINNIVSTTTYLADVTDAPVVNAARSRYFTGEVLPTHTVIGVAALARPQLLVEISAVAYLGDL GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 3->100|Y1251_PYRAB|7e-16|36.5|96/127| BL:PDB:NREP 1 BL:PDB:REP 1->100|2dyyG|3e-15|35.7|98/125| RP:PDB:NREP 1 RP:PDB:REP 2->101|2dyyG|8e-22|35.7|98/125| RP:PFM:NREP 1 RP:PFM:REP 1->101|PF01042|7e-11|40.0|100/119|Ribonuc_L-PSP| HM:PFM:NREP 1 HM:PFM:REP 2->100|PF01042|1.5e-26|35.7|98/121|Ribonuc_L-PSP| RP:SCP:NREP 1 RP:SCP:REP 2->100|1jd1A|2e-21|28.1|96/126|d.79.1.1| HM:SCP:REP 1->103|1nq3A_|1.9e-27|44.6|101/0|d.79.1.1|1/1|YjgF-like| OP:NHOMO 664 OP:NHOMOORG 516 OP:PATTERN -----11-1111111---111------111-----------------1----1-111--11---1--- 112-1---112----1-11-1---1111111--121-242------------1-------12--1-11211-------1-112--111-1-11111---11-11111-1---------------1-----------11111---111-1111111221111111112111111-1111111111211111--112222222212222221111112221111---------2111111111111111-1111-------------------------------------------------------------------------1-------------1------1-2-------1--3----1-111--111--111--------1-----11-------------2-11111-12----211--------12------1----1-111111111--------------------------------------1-3--35431211323-----2222------4222241----------1-1-31--1-1111111111111112111-1-3--2--1221-1-11---11--1-32--112-1-------1---1-1111--1--2212112--12111-11-31111111-112---1111-------111-1-1111111111--111111111-111111113421-1-11-111111111111111--1111---133313333111-1-------111111122---------------1111113121112222333212323222211111111111-12-------1--11-------------1--------------------------------------------------------1 ----11------11--1--1111----111111211-1-1111-----1-2-11--2--1-1----------------------------211121-1--11-111---1-1121---------11-21111-11-----1-----------------1---21111-------1--11---------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 100.0 SQ:SECSTR cEEEEEccccTTTcccccccHHHHHHHHHHHHHHHHHHTTccGGGEEEEEEEEcccccHHHHHHHHHHHHHTTTccEEEEEEccccGGGGccEEEEEEEEcccc PSIPRED cEEEccEEEcccccEEccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEEEcccc //