[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53195.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:207 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 74->126 G6PI_MYCTU 4e-04 35.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53195.1 GT:GENE BAF53195.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 250011..250634 GB:FROM 250011 GB:TO 250634 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53195.1 LENGTH 207 SQ:AASEQ MSGTAIMYDTTVVPSKKEIAQAWTGYVDLQGSYRLVDTVDGEVGVEVLISKDREGRLLQIPFSYRSAEINPEQTLSTLEHGVLGKRWVTNALGDPVAVREFIRTILTGDDGAARSDGVKGYLDIKGSGDAESVDLQDVKLTEVTRQRAIGSVTINGERKQFSLRLPQLLKNFRKTAAGHTATTLRMVAAHPEKDDVELLVAEFNWIE GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 74->126|G6PI_MYCTU|4e-04|35.8|53/553| SEG 35->48|lvdtvdgevgvevl| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------1-111--------------------------1------1-------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEEEEEccHHHHHHHHHEEEEEEcEEEEEEcccccEEEEEEEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHEEcccccccccccEEEEEEEccccccEEEHHHEEEEEEEHHccEEEEEEccEEEEEEEEccHHHcccccccccccccEEEEEEEEcccccEEEEEEEEcccc //