[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  379/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.190.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->69 2hs5A PDBj 7e-04 50.0 %
:BLT:PDB   106->253 2p19A PDBj 2e-80 100.0 %
:RPS:PDB   23->253 3eetA PDBj 3e-28 21.6 %
:RPS:SCOP  23->70 1e2xA1  a.4.5.6 * 1e-11 22.9 %
:RPS:SCOP  106->253 2p19A1  d.190.1.2 * 7e-48 100.0 %
:HMM:SCOP  16->120 1v4rA1 a.4.5.6 * 3e-18 39.4 %
:HMM:SCOP  95->250 2fa1A1 d.190.1.2 * 2.7e-38 40.6 %
:RPS:PFM   27->69 PF00392 * GntR 4e-05 48.8 %
:RPS:PFM   112->244 PF07702 * UTRA 4e-18 39.8 %
:HMM:PFM   108->244 PF07702 * UTRA 2.9e-37 40.1 137/141  
:HMM:PFM   25->87 PF00392 * GntR 9.8e-18 44.4 63/64  
:BLT:SWISS 15->246 YVOA_BACSU 2e-24 26.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53199.1 GT:GENE BAF53199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(254853..255614) GB:FROM 254853 GB:TO 255614 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53199.1 LENGTH 253 SQ:AASEQ MTTEAPIWPAELFEDLDRNGPIPLYFQVAQRLEDGIRSGVLPPGARLENEISVAKHLNVSRPTVRRAIQEVVDKGLLVRRRGVGTQVVQSHVTRPVELTSFFNDLKNANLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIPVAILENYLPPAFNDVSLDELEKGGLYDALRSRGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVERVALDNSGQVIELGSHCYRPDMYNFETTLVAR GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 15->246|YVOA_BACSU|2e-24|26.3|232/243| SEG 71->89|vvdkgllvrrrgvgtqvvq| BL:PDB:NREP 2 BL:PDB:REP 27->69|2hs5A|7e-04|50.0|42/205| BL:PDB:REP 106->253|2p19A|2e-80|100.0|148/148| RP:PDB:NREP 1 RP:PDB:REP 23->253|3eetA|3e-28|21.6|227/238| RP:PFM:NREP 2 RP:PFM:REP 27->69|PF00392|4e-05|48.8|43/64|GntR| RP:PFM:REP 112->244|PF07702|4e-18|39.8|133/141|UTRA| HM:PFM:NREP 2 HM:PFM:REP 108->244|PF07702|2.9e-37|40.1|137/141|UTRA| HM:PFM:REP 25->87|PF00392|9.8e-18|44.4|63/64|GntR| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| GO:PFM GO:0003677|"GO:DNA binding"|PF07702|IPR011663| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF07702|IPR011663| GO:PFM GO:0045449|"GO:regulation of transcription"|PF07702|IPR011663| RP:SCP:NREP 2 RP:SCP:REP 23->70|1e2xA1|1e-11|22.9|48/73|a.4.5.6| RP:SCP:REP 106->253|2p19A1|7e-48|100.0|148/148|d.190.1.2| HM:SCP:REP 16->120|1v4rA1|3e-18|39.4|99/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 95->250|2fa1A1|2.7e-38|40.6|155/0|d.190.1.2|1/1|Chorismate lyase-like| OP:NHOMO 710 OP:NHOMOORG 379 OP:PATTERN -------------------------------------------------------------------- -21152-1112---11111-13--241111125111-2323---132--112423--3--1121314354--------1---3-------1----------------1-1-----------------------------1-------------------------------------------222-----1-21111112212111113322121211122111122321----------------------3111131-21211--1-21211-121---1222111-----------111111111111111-1111111---23---111111112--2222-----2----33-2--3--1----1-----122---------11--------44444443443----------2--4112221222331111-121----122---------------------------------------------------233133333331212211222222225222311--111-2-111--1311-1--1111------------1------1------1------1--1----1----------------------------------2---1-1-------------------------1------31-111-3333332333-3333332333333333333112-2---423434344434444413221223--122222222222---------------1-1--------------------------133132123-1--1-111---------1---1-----11211--11111111---------------------------------------------------2----3-1-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 99.2 SQ:SECSTR ##TTcccccHHHHHHHHTcccHcHHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHTTcEEEcccEEEccccccEEEEccccccccccHHHHHcccTTccEEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEEEETTEEEEEEEEEHHHHTTcTTccTTTTcHHHHHHTTccccEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEETTTEEEEEEEEEEETTTEEEEcccccc DISOP:02AL 1-6,8-19| PSIPRED ccccccccccHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEccccccccHHHccHHHHHHHcccccEEEEEEEEEEcccHHHHHHcccccccEEEEEEEEEEEccEEEEEEEEcccHHHccccHHHHHcccHHHHHHHccccEEEEEEEEEEEEccHHHHHHcccccccEEEEEEEEEEcccccEEEEEEEEEcccEEEEEEEEEEc //