[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53226.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  140/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.110.3
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->122 1d06A PDBj 5e-10 30.8 %
:RPS:PDB   10->122 1d06A PDBj 4e-14 27.9 %
:RPS:SCOP  5->122 1s66L  d.110.3.2 * 2e-22 24.1 %
:HMM:SCOP  17->132 1dp6A_ d.110.3.2 * 4e-24 35.1 %
:RPS:PFM   11->121 PF00989 * PAS 2e-08 29.9 %
:HMM:PFM   16->123 PF08448 * PAS_4 1.2e-17 29.1 103/110  
:BLT:SWISS 17->142 FIXL_AZOC5 8e-11 28.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53226.1 GT:GENE BAF53226.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(284310..284747) GB:FROM 284310 GB:TO 284747 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53226.1 LENGTH 145 SQ:AASEQ MVDFDTIAARLVTETEEAIIYATRDGIIRLWNGGSEKLFGYTAGEALGKSLDIIIPEKHRKAHWDGWDRVMESGKTRYGSEPLNVPGIRADGSKMSLEFSITILKDDSGKIEGVAAFLRDVTANWDEKKALRIRIKELERQIEGQ GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 17->142|FIXL_AZOC5|8e-11|28.3|120/504| BL:PDB:NREP 1 BL:PDB:REP 17->122|1d06A|5e-10|30.8|104/130| RP:PDB:NREP 1 RP:PDB:REP 10->122|1d06A|4e-14|27.9|111/130| RP:PFM:NREP 1 RP:PFM:REP 11->121|PF00989|2e-08|29.9|107/112|PAS| HM:PFM:NREP 1 HM:PFM:REP 16->123|PF08448|1.2e-17|29.1|103/110|PAS_4| GO:PFM:NREP 1 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00989|IPR013767| RP:SCP:NREP 1 RP:SCP:REP 5->122|1s66L|2e-22|24.1|116/119|d.110.3.2| HM:SCP:REP 17->132|1dp6A_|4e-24|35.1|114/0|d.110.3.2|1/1|PYP-like sensor domain (PAS domain)| OP:NHOMO 244 OP:NHOMOORG 156 OP:PATTERN -----------------------1-111-1-1--1---------2--1--753--------------- 132----1111----11--------1---------------2112-------1-----------1------------------------------------------11----------------------------------------1-------------------1-------------1----------------------------------------1------------------------------------------------------------------------------------------------------1--------------------------------------1------------------124221111--1-------------23323212-2--1111--1-111223----------1-1-------------2---------------------------------11-------1112111111122122222-11-21112-2---4------411-11-112-1----------421111-1-------11--2323116-31221-3-1------------------------2------1--------1111----------------5-----------2---------------------------------------------------------------------------------------------2-2-----------------------------11111----111---11-----------------------------------------------------------------------------------------------2- ------------11----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 97.2 SQ:SECSTR ##GcccccHHHHTTcccEEEEEETTccEEEEcHHHHHHHcccHHHHTTccGGGGccTTHHHHHHHHHHHHHHHcccccTTccEEEEEEcTTccEEEEEEEEEEEEEEETTEEEEEEEEEEccHHHHHHHHHHHHHHHTccccc## DISOP:02AL 140-146| PSIPRED cccHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHcccHHHHccccHHHHccHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccEEEEEEEEEEEEcccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcc //