[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53239.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->120 PF03188 * Cytochrom_B561 6.3e-06 18.1 83/137  
:BLT:SWISS 36->134 SSTT_ACIBT 1e-04 30.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53239.1 GT:GENE BAF53239.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 303485..303889 GB:FROM 303485 GB:TO 303889 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53239.1 LENGTH 134 SQ:AASEQ MKTFNPTMIAGLIGVLYFVLLTLIFSIQDMELAAEIAFGIVTIVGLIAVWDNFRDRNNSTWKTWTGLVGGLLIAVPGICLLVGNLVLLAVDGNPSTMVNTLLSVAGIGAIFLLPIGIIMCLIAGFNRFYAALKV GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 36->134|SSTT_ACIBT|1e-04|30.9|97/400| TM:NTM 4 TM:REGION 6->28| TM:REGION 31->52| TM:REGION 66->88| TM:REGION 100->122| HM:PFM:NREP 1 HM:PFM:REP 37->120|PF03188|6.3e-06|18.1|83/137|Cytochrom_B561| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //