[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53240.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  250/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
b.58.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->89 1ibqA PDBj 3e-04 31.4 %
:BLT:PDB   61->179 1o65B PDBj 5e-10 29.7 %
:HMM:SCOP  1->213 1o65A_ b.58.1.2 * 7.5e-53 36.1 %
:RPS:PFM   61->166 PF03473 * MOSC 2e-04 36.2 %
:HMM:PFM   49->166 PF03473 * MOSC 1.7e-22 31.6 117/133  
:BLT:SWISS 5->181 YFLK_BACSU 8e-20 33.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53240.1 GT:GENE BAF53240.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 303891..304526 GB:FROM 303891 GB:TO 304526 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53240.1 LENGTH 211 SQ:AASEQ MPGLVLSTNVAHIQQDPGGDDRISGINKLPVATGIDVFIPGPNYGDGSGVVGDAIGDSLHHGGAHKAIYAYSREELDFFDPTYRNGYFGENLTTSGIVLEDLLINQQVRIGTTLLEVSIPRRPCRTFAHWLDIKGWLKTFTQRGLPGSYFRVIEEGHINPGDPIEVLQAPDHDITMSMAFRAKMGNKDLARRVVAANCLPARYHEELLKLI GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 5->181|YFLK_BACSU|8e-20|33.7|169/221| BL:PDB:NREP 2 BL:PDB:REP 4->89|1ibqA|3e-04|31.4|86/325| BL:PDB:REP 61->179|1o65B|5e-10|29.7|118/217| RP:PFM:NREP 1 RP:PFM:REP 61->166|PF03473|2e-04|36.2|105/139|MOSC| HM:PFM:NREP 1 HM:PFM:REP 49->166|PF03473|1.7e-22|31.6|117/133|MOSC| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF03473|IPR005302| GO:PFM GO:0030151|"GO:molybdenum ion binding"|PF03473|IPR005302| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF03473|IPR005302| HM:SCP:REP 1->213|1o65A_|7.5e-53|36.1|202/233|b.58.1.2|1/1|PK beta-barrel domain-like| OP:NHOMO 313 OP:NHOMOORG 268 OP:PATTERN -------------------------------------------------------------------- -21-21-1111--11--11-11--111111111111111212--1-11----1111----111-2-1111------------1---------------------1-------------------------------111-----1----1----------------1--2-------------112-------1222222221222222-12211222-111---1111112111111111111111111111--------------------------------------------------------------------------------1---------------------------------------1-1----------21---11-----11111111111-11-1111-----111111-221---1-----21-11--1------------1---------------------------------1---------111111-1111---21111111--2222-111111-1--1-----------1-------------1--------------------------1-1---11-1-1111-1---------1------1--1--1-1--1----1---------1-1------1-----------1-----1-1-1---------1----1------------111----------------1---------1------------------------1-------111-1111-11----------1--212211-------2-------------2--1------1111--11111111--------------------------------------------------------------- -----------------1-----111----------------------112222-1111111-------------------------------------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 82.9 SQ:SECSTR ###EEEcTEEEEEEEETTcccEEEEcTTccHHTTccccccccccccccEEEEEEEEEEEEcccGGGcEEEEETHHHHHHHHHcGGGGTcccEEEccccTTTccTTcEEEETTEEEEEEEEccccTHHHHHTTcTTHHHHHHHHTcccEEEEEEEcEEEETTccEEEEEccc#cccHHHH################################ DISOP:02AL 1-1| PSIPRED cccEEEEEEEcEEEEccccccEEEEEEEEEcccccEEEccHHHEEccccccccccccccccccccHHEEEEcHHHHHHHHHccccccccccEEEEcEEHHHcccccEEEEccEEEEEccccccHHHHHHHHccccccHHHHHccccEEEEEEccccEEcccccEEEEEcccccccHHHHHccccccHHHHHHHHccccccHHHHHHHHHHc //