[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53253.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  491/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
c.57.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->149 2g4rA PDBj 6e-24 41.5 %
:RPS:PDB   2->147 1eavA PDBj 4e-14 30.7 %
:RPS:SCOP  1->149 2g2cA1  c.57.1.1 * 5e-29 22.5 %
:HMM:SCOP  1->149 2g2cA1 c.57.1.1 * 3e-32 39.2 %
:RPS:PFM   15->130 PF00994 * MoCF_biosynth 1e-04 34.5 %
:HMM:PFM   5->141 PF00994 * MoCF_biosynth 2.3e-25 34.4 131/144  
:BLT:SWISS 5->149 MOACB_CHLTE 3e-22 40.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53253.1 GT:GENE BAF53253.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(316268..316729) GB:FROM 316268 GB:TO 316729 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53253.1 LENGTH 153 SQ:AASEQ MTALVIVASTRAAAGVYEDRSGPILVSWLRAKGFDTPDPVIVADADLPAFLDELKFPQVVLISGGTGLTPDDITVDTLIPRLDKEIPGIAHAFWNYSMDAVPTAVLSRTVAGTIGSSFIMALPGSTGAARDATAVLDPLIDHITGTLQGHHEH GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 5->149|MOACB_CHLTE|3e-22|40.8|142/312| BL:PDB:NREP 1 BL:PDB:REP 15->149|2g4rA|6e-24|41.5|135/153| RP:PDB:NREP 1 RP:PDB:REP 2->147|1eavA|4e-14|30.7|140/154| RP:PFM:NREP 1 RP:PFM:REP 15->130|PF00994|1e-04|34.5|110/143|MoCF_biosynth| HM:PFM:NREP 1 HM:PFM:REP 5->141|PF00994|2.3e-25|34.4|131/144|MoCF_biosynth| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF00994|IPR001453| RP:SCP:NREP 1 RP:SCP:REP 1->149|2g2cA1|5e-29|22.5|142/152|c.57.1.1| HM:SCP:REP 1->149|2g2cA1|3e-32|39.2|148/0|c.57.1.1|1/1|Molybdenum cofactor biosynthesis proteins| OP:NHOMO 731 OP:NHOMOORG 610 OP:PATTERN ---------------111111111---1-------11-1---111-1111111----11--------- 111111111111-212222-221122222222222221221111111211---111-1--11112111111-------11111111-2-------------1-1--11-----------------11111111121--------11-211111----11----1--1-1-1------------11-11---1-111111111111111111---1111-111--11-----111---1----------111--1---------------------------------------------------------------------11111111111111111---1111--11--111--1111--1111-11--1112111-----11---1-1-1---11111111111-112121--1-1------1------1112---11111111------------111-------------------------------11------11111111-1111111111111-111--------1111111--11---1111111----------111-1-11111111111-111111121--1-1-1111-11111111-11111111111-1--11-1-1--1--1111111111111111111----21-------12121222222222222-222222222222222222222211111222222222222222222222222--111111111111---------------1-11111111111111111111111---1111111121111111111---------11111111111111111-1-11--------1-1--------------------------------------------1---1---11- ----111-------1111-1111212111-1-1111-111-111-11-11--1---111------------------------------1211111------111------1222--1----1-2-12-3421222----2-11----1--112-211----1111-2-1-111111-15-----1-21-11---111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 97.4 SQ:SECSTR #EEEEEEEcHHHHTTcccccHHHHHHHHHHHTcEEEEEEEEEccHcHHHHHHHHHcccEEEEEccccccTTccHHHHHHTTccEEcHHGcHHHHHHHHTGTcGGGGccccEEHEETTEEEEEcccHHHHHHHHHHHHHHHHHHHHcHTcG### DISOP:02AL 150-154| PSIPRED cEEEEEEEcccccccccccccHHHHHHHHHHccccccccEEccHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHcccccHHHHHHHHHcccccccEEEEEEEEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccc //