[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53266.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  783/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->159 1z3aA PDBj 4e-29 44.7 %
:RPS:PDB   12->159 2b3jD PDBj 3e-33 37.0 %
:RPS:SCOP  12->155 1wwrA1  c.97.1.2 * 6e-30 36.2 %
:HMM:SCOP  7->159 1z3aA1 c.97.1.2 * 3e-46 51.0 %
:RPS:PFM   13->111 PF00383 * dCMP_cyt_deam_1 3e-15 47.9 %
:HMM:PFM   11->111 PF00383 * dCMP_cyt_deam_1 1.3e-28 40.4 99/102  
:BLT:SWISS 17->159 TADA_SHIFL 1e-28 44.7 %
:PROS 62->100|PS00903|CYT_DCMP_DEAMINASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53266.1 GT:GENE BAF53266.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 328913..329392 GB:FROM 328913 GB:TO 329392 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53266.1 LENGTH 159 SQ:AASEQ MGVLPVQARIKDDERRMRHALDIARQTPEGDVPVGAVIYAPTGEILATATNRREADRDPTAHAEIIALRRAARRFSDGWRLSDCTAVVTLEPCSMCAGALVGARIGRIVFGAFEPRTGACGSVFDVVRDPAVLHKVEVSGGILEPECAALMTEFFELHR GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 17->159|TADA_SHIFL|1e-28|44.7|141/167| PROS 62->100|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| SEG 61->74|ahaeiialrraarr| BL:PDB:NREP 1 BL:PDB:REP 17->159|1z3aA|4e-29|44.7|141/156| RP:PDB:NREP 1 RP:PDB:REP 12->159|2b3jD|3e-33|37.0|146/150| RP:PFM:NREP 1 RP:PFM:REP 13->111|PF00383|3e-15|47.9|96/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 11->111|PF00383|1.3e-28|40.4|99/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 12->155|1wwrA1|6e-30|36.2|141/151|c.97.1.2| HM:SCP:REP 7->159|1z3aA1|3e-46|51.0|151/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 836 OP:NHOMOORG 816 OP:PATTERN -------------------------------------------------------------------- 11111-1111111111111-1111111111111111111111211111111111111111111111111111111111111111-111111111121--1111111111111111111111111111111111111----------1111111111111111111111111111111111111111--11-111111111111111111111111111111111111111112111111--1111111111111111111111111111111111111111111111111111-111111-1111111111111111111111111111111111111111111111111111111111111111111111--111111-11111-21111111111111111111111-11111111111-2112--22-11111111-1-----1--1111111111111111--111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211-------------------------111111111111111111111111111111111-11111-1-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111121111----1---1111111111111111111111111111111------------------1-----------------------------------111 -----------1-----1-------------------------1-------------------------------------------1--1-----1-11--------51----------------------------------------------------11-1----------1-12111121112-1121111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 96.9 SQ:SECSTR #####HHHccHcHHHHHHHHHHHHHHHTTTccccEEEEEETTTEEEEEEEccHHHHTcTTccHHHHHHHHHHHHHTHccccTTcEEEEEEcccHHHHHHHHHHTccEEEEEEccTTTcTcTTcccGGGcTTcccccEEEccTTHHHHHHHHHHHHHHHH DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEccccccccccccHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHc //