[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53271.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   100->158 1dlcA PDBj 4e-04 21.4 %
:RPS:PFM   77->221 PF02592 * DUF165 3e-21 38.1 %
:HMM:PFM   75->221 PF02592 * DUF165 8.9e-41 37.8 143/145  
:BLT:SWISS 57->243 YPDP_BACSU 5e-15 27.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53271.1 GT:GENE BAF53271.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(334064..334816) GB:FROM 334064 GB:TO 334816 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53271.1 LENGTH 250 SQ:AASEQ MVVDVQNQSHTPETQPQPGQGAAKKTPVASGNSTFIHIQPSLYPILLALFVAVFLISNITATKGVEIGPLVTDGAFFLFPISYVLGDVLAECYGFKSTRRAILTGFGITILAAISFYISIWLPGASFWEGQEAFEATLGLVPQIIVASLAGYIVGQLLNAKVLVAIKKRTGEKSLWARLIGSTVVGEFADTLLFCAIAAPVIGIATAPDFINYVVVGFVWKTLLEVILMPITYAVIRWVKRREGYETFDA GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 57->243|YPDP_BACSU|5e-15|27.6|185/229| TM:NTM 6 TM:REGION 40->62| TM:REGION 69->91| TM:REGION 102->124| TM:REGION 141->163| TM:REGION 180->202| TM:REGION 214->236| RP:PDB:NREP 1 RP:PDB:REP 100->158|1dlcA|4e-04|21.4|56/584| RP:PFM:NREP 1 RP:PFM:REP 77->221|PF02592|3e-21|38.1|139/143|DUF165| HM:PFM:NREP 1 HM:PFM:REP 75->221|PF02592|8.9e-41|37.8|143/145|DUF165| OP:NHOMO 195 OP:NHOMOORG 186 OP:PATTERN -----1-----------------1111--11121----1--1------1-1-2--------------- 1----1-1111---1------1---1------11111111------1-----11111111---1------------------------1111-1--2----1-1-11111--------1111111----------------111-1---1---11-------------------------------11----11---------------1-1111-------111------111111111111111111--11------------------------------------------------------------------------------------------------------------1---------11------------------------------------------1-------------------1-------------------------------------------1---------------1121--------1---------------------111--111--------------1-1-1-------------1-----1111--2-----------------11----------------------------------------11111-1----11-11111---------------12-------------------------------------1-1-----------------1-----------------------1-111-111-1-------------------------------------------------------------------------1111111111-------1111111-11----11---------------------------11-2311111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 22.4 SQ:SECSTR ###################################################################################################HHHTTccccccHHHHHHHHHHH###HHTcccHHHHHHHHHHHHHHHTccccHHHHHHHH############################################################################################ DISOP:02AL 5-29,250-251| PSIPRED cEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //