[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53279.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y315_CORGB   RecName: Full=UPF0133 protein cgR_0315;

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:103 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  39->98 1j8bA  d.222.1.1 * 9e-08 28.8 %
:HMM:SCOP  6->98 1j8bA_ d.222.1.1 * 5.8e-27 44.6 %
:RPS:PFM   32->101 PF02575 * DUF149 1e-07 41.4 %
:HMM:PFM   11->101 PF02575 * DUF149 2.8e-32 44.0 91/93  
:BLT:SWISS 1->103 Y315_CORGB 2e-29 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53279.1 GT:GENE BAF53279.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 344900..345211 GB:FROM 344900 GB:TO 345211 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53279.1 LENGTH 103 SQ:AASEQ MTQPDMSQILAQAQQMQAQLQAAQQEILATTVVGNAGNGLVTVTMAGNGEVSAVTVDPKVVDPEDVETLQDLLLGAFKDAHNKVANVAEEKMGPLSQGMGGLF GT:EXON 1|1-103:0| SW:ID Y315_CORGB SW:DE RecName: Full=UPF0133 protein cgR_0315; SW:GN OrderedLocusNames=cgR_0315; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->103|Y315_CORGB|2e-29|100.0|103/103| SEG 8->29|qilaqaqqmqaqlqaaqqeila| SEG 54->68|vtvdpkvvdpedvet| RP:PFM:NREP 1 RP:PFM:REP 32->101|PF02575|1e-07|41.4|70/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 11->101|PF02575|2.8e-32|44.0|91/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 39->98|1j8bA|9e-08|28.8|59/92|d.222.1.1| HM:SCP:REP 6->98|1j8bA_|5.8e-27|44.6|92/92|d.222.1.1|1/1|YbaB-like| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -----11111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6,8-21,84-96| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcccEEEEEEEccccEEEEEEcHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //