[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53285.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  213/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.72.2
:423 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->208 1gqyB PDBj 4e-06 31.5 %
:RPS:PDB   59->394 2am1A PDBj 3e-26 16.1 %
:RPS:SCOP  61->257 1e8cA3  c.72.2.1 * 2e-16 25.7 %
:HMM:SCOP  48->291 1p3dA3 c.72.2.1 * 1.5e-33 29.5 %
:RPS:PFM   64->185 PF08245 * Mur_ligase_M 7e-09 41.9 %
:RPS:PFM   311->409 PF08353 * DUF1727 5e-15 45.5 %
:HMM:PFM   311->410 PF08353 * DUF1727 3.2e-28 41.0 100/113  
:HMM:PFM   64->272 PF08245 * Mur_ligase_M 4e-21 26.3 179/188  
:BLT:SWISS 43->85 MURD_BORAP 7e-04 44.2 %
:BLT:SWISS 60->182 MURD_NITWN 1e-10 37.3 %
:BLT:SWISS 246->338 MURE_LISMO 3e-04 26.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53285.1 GT:GENE BAF53285.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(354593..355864) GB:FROM 354593 GB:TO 355864 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53285.1 LENGTH 423 SQ:AASEQ MKLSLPAPLRRLRSTAAIVSAKVATSASKATGRGSGGMIGGLVASKVDPDIMSNLINNRPTVLVTGTNGKSTTTRMLAAAMRSTYTVATNEGGDNMDAGIISALLAGRNASHVVLEVDELHVPAAIERLKPDALVLLNLSRDQLDRVGEINKIERVLRDAVRSRPEMTVIANCDDVLVTSVAFDAENVIWVGAGTGWQGESVTCPRTESRILHDGRHWSAEKTLLDGRTFARPTPSWEVDGDTIHSPSGDLTLDLNLPGQANRGNAAQAIAASTVFNVPVSSALPAVNSVNNVAGRYSTITVGEHKVHLLLAKNPAGWQEALSMVDRTADGLVIVVNGQVADGEDLSWLWDVRFEDFENLSVKASGERGTDLAVRLTYAEINHELISNPVDAIAACPPGRIEVLANYTAFRDLKKALEKGTEQ GT:EXON 1|1-423:0| BL:SWS:NREP 3 BL:SWS:REP 43->85|MURD_BORAP|7e-04|44.2|43/451| BL:SWS:REP 60->182|MURD_NITWN|1e-10|37.3|118/466| BL:SWS:REP 246->338|MURE_LISMO|3e-04|26.9|93/491| SEG 3->31|lslpaplrrlrstaaivsakvatsaskat| SEG 259->272|gqanrgnaaqaiaa| BL:PDB:NREP 1 BL:PDB:REP 51->208|1gqyB|4e-06|31.5|149/469| RP:PDB:NREP 1 RP:PDB:REP 59->394|2am1A|3e-26|16.1|299/442| RP:PFM:NREP 2 RP:PFM:REP 64->185|PF08245|7e-09|41.9|117/187|Mur_ligase_M| RP:PFM:REP 311->409|PF08353|5e-15|45.5|99/111|DUF1727| HM:PFM:NREP 2 HM:PFM:REP 311->410|PF08353|3.2e-28|41.0|100/113|DUF1727| HM:PFM:REP 64->272|PF08245|4e-21|26.3|179/188|Mur_ligase_M| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 1 RP:SCP:REP 61->257|1e8cA3|2e-16|25.7|175/234|c.72.2.1| HM:SCP:REP 48->291|1p3dA3|1.5e-33|29.5|210/215|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| OP:NHOMO 214 OP:NHOMOORG 214 OP:PATTERN ---------------------------------1---------------------------------- ---1-11111111111-11-111111111111111111111111-----1111111--1111-11-111111111111--111-----------------------------------------------------11111---11-11-111----------11--111------------------11-1-----------------------------------------11111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111--1111111111111-111111-111-1--11111111--111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 364 STR:RPRED 86.1 SQ:SECSTR ##################################################HHHHTGGGcEEEEEEcccccccHHHHHHHHTTTccEEEcccTTcccTTHHHHHHHTcTTccEEEEEcccTHHHHHHHHHcccEEEEccccccccTTcccHHHHHHHHGGGTccTcTTcEEEEEccGGGGGGcccccEEEEEcTTccccEEEEEEEEEEEEEEcccEEEEEEEEEEccEEEEEEETEEccccEEEEETTcccEEEEcccccHHHHHHHHHHHHHHHTTccHHHHHHHGGGcccccccccEEccTTTEEEEEcccccHHHHHHHHHHTcccccEEEEEEEcccccTTHHHHHHHGGGccTTTcEEEEEcTTHHHHHHHHHccTTcEEEEEccccccHccTTcEEEEcTTccEEEET######### DISOP:02AL 1-3,418-424| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHcccccEEEEEcccccHHHHHHcccccEEEEEcccHHHHHHcccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHccccEEEEEcccccccccEEccccccEEEEcccccccccccccccccccccccEEEEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEcccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccEEEcccEEEEEccHHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHcc //