[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53293.1
DDBJ      :             hypothetical protein
Swiss-Prot:DHAS_CORFL   RecName: Full=Aspartate-semialdehyde dehydrogenase;         Short=ASA dehydrogenase;         Short=ASADH;         EC=1.2.1.11;

Homologs  Archaea  53/68 : Bacteria  801/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:344 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   17->344 2qz9B PDBj 5e-61 43.2 %
:RPS:PDB   17->342 1brmB PDBj 5e-40 23.1 %
:RPS:SCOP  17->158 2gyyA1  c.2.1.3 * 1e-29 38.3 %
:RPS:SCOP  130->330 1brmA2  d.81.1.1 * 6e-57 28.1 %
:HMM:SCOP  1->157 2g17A1 c.2.1.3 * 1.9e-50 46.1 %
:HMM:SCOP  130->330 1mb4A2 d.81.1.1 * 4e-64 47.7 %
:RPS:PFM   17->114 PF01118 * Semialdhyde_dh 6e-12 44.2 %
:RPS:PFM   140->329 PF02774 * Semialdhyde_dhC 5e-25 48.4 %
:HMM:PFM   140->329 PF02774 * Semialdhyde_dhC 8.4e-57 48.3 176/184  
:HMM:PFM   4->117 PF01118 * Semialdhyde_dh 6.1e-33 43.6 110/121  
:BLT:SWISS 17->344 DHAS_CORFL 0.0 99.7 %
:PROS 244->258|PS01103|ASD
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53293.1 GT:GENE BAF53293.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 368760..369794 GB:FROM 368760 GB:TO 369794 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53293.1 LENGTH 344 SQ:AASEQ MTTIAVVGATGQVGQVMRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQATEESLKGIDVALFSAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSLVKGIIANPNCTTMAAMPVLKPLHDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDHNVEFVHDGQAADAGDVGPYVSPIAYNVLPFAGNLVDDGTFETDEEQKLRNESRKILGLPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQEILGAASGVKLVDVPTPLAAAGIDESLVGRIRQDSTVDDNRGLVLVVSGDNLRKGAALNTIQIAELLVK GT:EXON 1|1-344:0| SW:ID DHAS_CORFL SW:DE RecName: Full=Aspartate-semialdehyde dehydrogenase; Short=ASA dehydrogenase; Short=ASADH; EC=1.2.1.11; SW:GN Name=asd; SW:KW Amino-acid biosynthesis; Diaminopimelate biosynthesis;Lysine biosynthesis; NADP; Oxidoreductase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->344|DHAS_CORFL|0.0|99.7|328/344| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 244->258|PS01103|ASD|PDOC00847| SEG 2->16|ttiavvgatgqvgqv| BL:PDB:NREP 1 BL:PDB:REP 17->344|2qz9B|5e-61|43.2|310/335| RP:PDB:NREP 1 RP:PDB:REP 17->342|1brmB|5e-40|23.1|324/357| RP:PFM:NREP 2 RP:PFM:REP 17->114|PF01118|6e-12|44.2|95/120|Semialdhyde_dh| RP:PFM:REP 140->329|PF02774|5e-25|48.4|159/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 140->329|PF02774|8.4e-57|48.3|176/184|Semialdhyde_dhC| HM:PFM:REP 4->117|PF01118|6.1e-33|43.6|110/121|Semialdhyde_dh| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 2 RP:SCP:REP 17->158|2gyyA1|1e-29|38.3|133/150|c.2.1.3| RP:SCP:REP 130->330|1brmA2|6e-57|28.1|192/210|d.81.1.1| HM:SCP:REP 1->157|2g17A1|1.9e-50|46.1|154/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 130->330|1mb4A2|4e-64|47.7|197/222|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 1035 OP:NHOMOORG 899 OP:PATTERN 11-1--1111111111-11111111111111111111111111-1-1--11111-111--2---1-11 1111211111111111111-11111111111111111111121111111111--1-1-1122111112221-111-1111111111111111111111111111111111--------------111111111111111111111111111111111111111111111111111111111111111111111122222222122222211111122211111111111111-1111111111111111111111-1111111-121111--1111111111111111111111111111-------------1111111111111-11111111111-1111111-11-11--11111111121111111-1111222111111112221111111111111111111-111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111-----1111111111111111111-111111111111111111-1111----111-21--1--111111111-11-111111111121212121111111112111111111111111111111111111221211111121111111111111111111---1111---11112222122222222222-2222222222222222221323222221111111111111111222222221-111111111111--21111111111121111111111111-111111111111112-22222222222222222111--1111121121111111111111111111111111111111111----------1-------------------------1111111111111 ------1-----11------------------------------------------------1-11--11111-111-11----1------1---1-1------1---1----------------------------------------------------------------1--111E112111113-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 328 STR:RPRED 95.3 SQ:SECSTR ################HHHHHHTTGGGGcEEEEEEcccTTcccccTTccccccEETTcHHHHHTccEEEEcccHHHHHHHHHHHHTTTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHHHHHTEEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEcGGGTcHHHHHHHHHHHHHHHHTTHHHHHcccccHHHHHHHHHHHHHHcccccTTTcccTccccccccTTcHHHHHHHTTcccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHcTTccccHccHHHHTTcccccEEEEEEcTTTTcTTEEEEEEEEETTcccccHHHHHHHHHHHH PSIPRED cEEEEEEccccHHHHHHHHHHHccccccEEEEEEEccccccEEEEEccEEEEEEccccccHHHHccccEEEEcccHHHHHHHHHHHHHcccEEEEcccccccccccEEEEccccHHHHHHHHccEEEcccHHHHHHHHHHHHHHHHccEEEEEEEcEEEEccccccHHHHHHHHHHHcccccHHHHcccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHccccEEEcccccHHHccccccEEEEEEEccccccccEEEEEEEEEccccHHHHHHHHHHHHHcc //