[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53297.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53297.1 GT:GENE BAF53297.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 373995..374339 GB:FROM 373995 GB:TO 374339 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53297.1 LENGTH 114 SQ:AASEQ MRAYPPMVDRPSFDFEAIERKLARQQIRNSQGHCSGTNGGGAESNGKETSGALNCSFDLRSLSSRQEAQQIGDFLWKLDPRAEVGGTSSRASFLCASDSSATSQGGGSDCNCCD GT:EXON 1|1-114:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,25-50,97-107| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHcccHHHcccccccEEEEEEcccccccccccccccccc //