[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53302.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->87 3f6vA PDBj 5e-07 32.9 %
:RPS:PDB   17->88 1bibA PDBj 2e-15 18.6 %
:RPS:SCOP  1->79 1fnnA1  a.4.5.11 * 5e-15 7.9 %
:HMM:SCOP  2->88 1u2wA1 a.4.5.5 * 2.2e-22 49.4 %
:RPS:PFM   16->63 PF01022 * HTH_5 3e-06 57.8 %
:HMM:PFM   17->63 PF01022 * HTH_5 1.2e-16 56.8 44/47  
:BLT:SWISS 1->76 Y1325_METJA 9e-10 44.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53302.1 GT:GENE BAF53302.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(376486..376761) GB:FROM 376486 GB:TO 376761 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53302.1 LENGTH 91 SQ:AASEQ MDDAERYAEIFKVLGEPVRLRILSHLAAEGCTPTTVNELTEIMGLSQPTISHHLKKMTDAGLLARIPEGRTVFHQVQPETFTSLRTILQIG GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->76|Y1325_METJA|9e-10|44.4|72/89| BL:PDB:NREP 1 BL:PDB:REP 12->87|3f6vA|5e-07|32.9|73/96| RP:PDB:NREP 1 RP:PDB:REP 17->88|1bibA|2e-15|18.6|70/294| RP:PFM:NREP 1 RP:PFM:REP 16->63|PF01022|3e-06|57.8|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 17->63|PF01022|1.2e-16|56.8|44/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 1->79|1fnnA1|5e-15|7.9|76/103|a.4.5.11| HM:SCP:REP 2->88|1u2wA1|2.2e-22|49.4|85/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 91 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- ----41121211-14--11-11--111-111131212414-111111-1---211-1---221-1111411-------------------------------------1-------------------------------------1-------1------1------2--------------------------------------------------1------------------------------------------------------------------------------------------------------------------------11----------------------------------1----------------------------------------------11---1---1-----1-----------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 100.0 SQ:SECSTR GGHHHHHHTccHHHHHHHHHHHHHHHTTcccTcccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHHTH DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEcHHHHHHHHHHHHcc //