[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53307.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->84 PF04976 * DmsC 0.00065 20.8 48/276  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53307.1 GT:GENE BAF53307.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(378767..379039) GB:FROM 378767 GB:TO 379039 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53307.1 LENGTH 90 SQ:AASEQ MTAFGIVTTVGICMFALSLLSALVLILRTKDFLTRVVLSDMVFYSMIAIYLIWVLNNPTSIAFEIALLAAVLGGVLPTLSMARIISKGRR GT:EXON 1|1-90:0| TM:NTM 3 TM:REGION 4->26| TM:REGION 34->56| TM:REGION 63->85| SEG 16->27|alsllsalvlil| SEG 66->76|allaavlggvl| HM:PFM:NREP 1 HM:PFM:REP 37->84|PF04976|0.00065|20.8|48/276|DmsC| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----11-111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,89-91| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //