[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53320.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  170/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   41->100 2bwyA PDBj 2e-04 16.7 %
:RPS:PFM   12->276 PF01874 * CitG 2e-35 40.6 %
:HMM:PFM   12->275 PF01874 * CitG 1.6e-68 40.9 257/277  
:BLT:SWISS 15->277 MDCB_PSEU2 6e-45 43.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53320.1 GT:GENE BAF53320.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(391692..392549) GB:FROM 391692 GB:TO 392549 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53320.1 LENGTH 285 SQ:AASEQ MHNTVKVQQAPIGRLATQALLAEVNLPHKPGLVGPDGSRGHQDMDIELMRKSAKVLEPTFSELAEAGKTIELGQELRDEIGKIGRRGEATMMNATGGVNTHRGAIWNVGLLVTAASGLMTQEDQPFTAFSITQRAGSLASIPDSFIDSSPRPGATARKKYKVGGAVSEAASGFPHVIAILQAMGFYAGNFTPSRELQIKGLITCMSSLDDTCILHRGGAEALAFVHGWATDLLVESPPNEGLDVEKLSAFDQHLTNRNLSPGGSADLLAGALFLTSIFGESHANH GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 15->277|MDCB_PSEU2|6e-45|43.4|258/291| RP:PDB:NREP 1 RP:PDB:REP 41->100|2bwyA|2e-04|16.7|60/440| RP:PFM:NREP 1 RP:PFM:REP 12->276|PF01874|2e-35|40.6|261/268|CitG| HM:PFM:NREP 1 HM:PFM:REP 12->275|PF01874|1.6e-68|40.9|257/277|CitG| OP:NHOMO 197 OP:NHOMOORG 170 OP:PATTERN -------------------------------------------------------------------- ----------1--------------1-----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11---1-11--111--1-1-------111-11-----------------------------------1------------------1-1-1--------------1--------1--------------11----1-2--1-------------------1----------------------------------------------1--------------------------------1-------1111111------11------111-1----11-12---11-2--12-------------------1---------------1-1--1--1---------------------------------------------1--------------------------------212212-1111111111-112111111111111111222111---2212222222222222111--111--1---------------------111--------11-11111----11111-11--1-1111-111--1-11111-------------111111-----1111111-------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 21.1 SQ:SECSTR ########################################ccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHTTccccccccEEEEGGGG######################################################################################################################################################################################### DISOP:02AL 1-8,282-286| PSIPRED ccHHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHccccccHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccEEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHccc //