[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53342.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->48 PF08695 * DUF1783 0.00031 19.0 42/125  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53342.1 GT:GENE BAF53342.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(412878..413063) GB:FROM 412878 GB:TO 413063 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53342.1 LENGTH 61 SQ:AASEQ MTGLLVVIIPLLLMLFAFAMERIESSFLHSNTPQSTEVKLAKDAIGAENLNDDDVQEASAA GT:EXON 1|1-61:0| TM:NTM 1 TM:REGION 1->23| SEG 4->15|llvviiplllml| HM:PFM:NREP 1 HM:PFM:REP 6->48|PF08695|0.00031|19.0|42/125|DUF1783| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,55-62| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHcccccccHHHHHHHHcc //