[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53355.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->59 PF07811 * TadE 5e-05 32.6 43/43  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53355.1 GT:GENE BAF53355.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 423849..424169 GB:FROM 423849 GB:TO 424169 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53355.1 LENGTH 106 SQ:AASEQ MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLAAYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVFPVEN GT:EXON 1|1-106:0| TM:NTM 1 TM:REGION 26->48| SEG 35->64|gliiaamatlaaylaavdaagaaarahaig| HM:PFM:NREP 1 HM:PFM:REP 17->59|PF07811|5e-05|32.6|43/43|TadE| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,104-107| PSIPRED ccccccccccHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccEEEEEccccEEEEEEEccccccEEEccccccccc //