[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53368.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  649/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->200 2zwrB PDBj 1e-19 40.7 %
:RPS:PDB   9->204 1bmiB PDBj 3e-23 16.8 %
:RPS:SCOP  27->211 1xm8A  d.157.1.2 * 4e-21 29.4 %
:HMM:SCOP  21->209 1dd6A_ d.157.1.1 * 8.4e-40 33.2 %
:RPS:PFM   58->157 PF00753 * Lactamase_B 8e-10 40.2 %
:HMM:PFM   25->190 PF00753 * Lactamase_B 3.1e-34 29.7 165/194  
:BLT:SWISS 26->199 YQGX_BACSU 2e-21 33.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53368.1 GT:GENE BAF53368.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 440844..441479 GB:FROM 440844 GB:TO 441479 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53368.1 LENGTH 211 SQ:AASEQ MAHDGLRVENIVTSGIFALDGGEWEVDNNIWVVGNDDEVFIIDAAHTAAPIIEAVGGRTVKGILCTHAHNDHITVAPELAKEFDAPIFVHPGDQMLWEETHGNLAHEDLADQQKFHIAGTELIVLNTPGHSPGSSCFYLPEANELFSGDTLFQGGPGATGRKYSSFDTIIESLKTSILDLPAETTVRTGHGDHTSVGAEAPHLEEWIKRGH GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 26->199|YQGX_BACSU|2e-21|33.9|174/211| BL:PDB:NREP 1 BL:PDB:REP 63->200|2zwrB|1e-19|40.7|135/207| RP:PDB:NREP 1 RP:PDB:REP 9->204|1bmiB|3e-23|16.8|196/230| RP:PFM:NREP 1 RP:PFM:REP 58->157|PF00753|8e-10|40.2|97/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 25->190|PF00753|3.1e-34|29.7|165/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 27->211|1xm8A|4e-21|29.4|177/254|d.157.1.2| HM:SCP:REP 21->209|1dd6A_|8.4e-40|33.2|184/216|d.157.1.1|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 998 OP:NHOMOORG 705 OP:PATTERN 11-----1111111-1--111-111531-112-----------1---11111-11---------1--- 1112332333333334444-4333434444443333334513322-22-11-222222--22214472334-------1113211111111111221--3-111131212--------------1--1---111--111221111----1-----------------------1-------1-11111--1212111111111121121111113111111111111111111111111111111111111111----------------------111111111111111111111111111-11111111111111111111211211111111111122111111111121111111111111111111-11-2111122111-11112111-1111111111111-22112111-111-11-11121-111-11---1----------------111--11-----------------------------121111----1-----1-1111--1-11111-11-111--12212121111111122121-11-1111111111112-3121111122--11111111212111111321111-1111111111111111-111----1111-211112212-21111111112111-11111------21222222222222222-2222222222222222222222221122222222222222222122222222-122222222222-211-----1111121--111-11111111--11111111---12111111112111111--111111111-22212222222211--11111-1-1111--1111------------1-2--------------------------1--------231 -----------1-121-1--11--1-1------1------------------------1---------------------------1---------------------31------------------------------------1-----------1---------1--------1-----1-112126-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 99.1 SQ:SECSTR ##cccEEETTEEEEEEEEEETTTEEEEEEEEEEEETTEEEEEccHHHHHHHHHHHHccEEEEEEcccccHHHHTTHHHHHHTTcEEEEEHHHHHHHHHTTcccccEEEccEEEEEETTEEEEEEcccccccTTccEEEETTTTEEEEETTcccTTcccccccTTcTTTHHHHHHHHHHHcTTccEEEEcccccccTHHHHHHHHHHHHHHT DISOP:02AL 1-3,211-212| PSIPRED cccccEEEEEEEEccEEEEcccccccccEEEEEEEccEEEEEcccccHHHHHHHHcccccEEEEEEcccHHHHcHHHHHHHHccccEEEcHHHHHHHHHcccccccEEEccccEEEEccEEEEEEEccccccccEEEEEccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHcc //