[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53373.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  248/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->269 3ckqA PDBj 6e-20 15.0 %
:RPS:SCOP  54->257 2bo4A1  c.68.1.18 * 2e-16 14.3 %
:HMM:SCOP  49->260 1xhbA2 c.68.1.17 * 5.2e-27 26.0 %
:RPS:PFM   56->165 PF00535 * Glycos_transf_2 4e-09 34.0 %
:HMM:PFM   56->180 PF00535 * Glycos_transf_2 2.1e-27 25.6 121/169  
:HMM:PFM   209->242 PF06825 * HSBP1 0.00021 40.6 32/54  
:BLT:SWISS 53->268 Y1222_METJA 2e-29 34.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53373.1 GT:GENE BAF53373.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(445282..446118) GB:FROM 445282 GB:TO 446118 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53373.1 LENGTH 278 SQ:AASEQ MRDCVPASCSRSMDFMTIKLSSLGSVAPNRKIGHHALGSIPIMDASKNSDFKDTWLVVPCYNEATVIREVLENALKTFPNIVAVNDGSPDNSAEEIHAAGAHLVNHPVNLGQGAAIQTGIEYARKQPGAKYFVTFDADGQHQVKDVVRMVERLRAEDVDIIVGTRFGRPRQADDQVPLIKRLVLRTVVLLSPKTRRLGLTDAHNGLRVFNQKVAQEMNIRMNGMSHASEIVDQIDERGWRISEEPVDILYTEYSMSKGQSLLNGVNILADGFLARRLP GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 53->268|Y1222_METJA|2e-29|34.1|214/243| RP:PDB:NREP 1 RP:PDB:REP 27->269|3ckqA|6e-20|15.0|233/302| RP:PFM:NREP 1 RP:PFM:REP 56->165|PF00535|4e-09|34.0|106/148|Glycos_transf_2| HM:PFM:NREP 2 HM:PFM:REP 56->180|PF00535|2.1e-27|25.6|121/169|Glycos_transf_2| HM:PFM:REP 209->242|PF06825|0.00021|40.6|32/54|HSBP1| RP:SCP:NREP 1 RP:SCP:REP 54->257|2bo4A1|2e-16|14.3|196/380|c.68.1.18| HM:SCP:REP 49->260|1xhbA2|5.2e-27|26.0|208/0|c.68.1.17|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 461 OP:NHOMOORG 331 OP:PATTERN --111--1111111----1---113--113--13422222321-11333-4361322334311-1--1 117-3--1111---11111-1-111-111111-----11111--1-11-1-1-221-1--121-121-1---------1-2-1---1111-1----1---1111132111---------------121211-123154432---71121---2-----1--1-1------1-1--------------------------1--1-1--11--------1211--11-------1--------------------1------------------1---11111111112-------------111-111111111122111222----21-----------------1--1-1-2-1-----1-2111--1----114-------------------1--------------------------------------1-11------------------------2--------------------------------------------------------1-------1-------111---11--------------------------1--41111-1---11-212-13343111212112------------------------1-----1-----1-11111-1211111111121------2------1---------------------------------------1--------------------1---------1---------------11-11--------------------------11--1---1-------1-------------------1----------1----1111111111111--21211122-----------------------------------------------1- ---------------11-11111111-1111--111-------111------1--11-11111---1-------------------------1--------------------------------------------------------------------1---1--------------------12-1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 97.5 SQ:SECSTR #####cTTcccccccccccTTcccTTTTcEEETTEEcccccHHHHHHTTTTccEEEEEEEcccTTTHHHHHHHHGGGcTTEEEEEcccccTHHHHHHTTTcEEEEccccccHHHHHHHHHHHcccHccccEEEEcccccccccTTHHHHHHHHHHccccccEEEEEEEccccTHHHHHTHHHHHHHHHHHcGGGGGGGcccTTcccEEEEHHHHTTcccTccGGGHHHHHHHHHHHHHcGGGEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHT## DISOP:02AL 1-7,39-49| PSIPRED cccHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHccccccccEEHHHHHHHHHHccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHccc //