[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53377.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  653/915 : Eukaryota  173/199 : Viruses  1/175   --->[See Alignment]
b.35.1c.2.1
:356 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->346 1uufA PDBj 7e-68 46.2 %
:RPS:PDB   9->355 2cf5A PDBj 9e-55 34.8 %
:RPS:SCOP  8->177 1uufA1  b.35.1.2 * 6e-31 34.7 %
:RPS:SCOP  155->315 1piwA2  c.2.1.1 * 2e-51 29.8 %
:RPS:SCOP  318->351 1uufA1  b.35.1.2 * 1e-04 35.3 %
:HMM:SCOP  8->195 1p0fA1 b.35.1.2 * 2.5e-54 47.7 %
:HMM:SCOP  152->316 1q1nA2 c.2.1.1 * 9.7e-46 40.0 %
:RPS:PFM   32->140 PF08240 * ADH_N 5e-12 42.0 %
:RPS:PFM   196->305 PF00107 * ADH_zinc_N 3e-10 41.1 %
:HMM:PFM   33->147 PF08240 * ADH_N 1.7e-33 48.1 106/109  
:HMM:PFM   189->311 PF00107 * ADH_zinc_N 7.7e-25 35.8 123/130  
:BLT:SWISS 9->349 ADHA_BACSU 8e-92 54.0 %
:PROS 66->80|PS00059|ADH_ZINC
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53377.1 GT:GENE BAF53377.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(450979..452049) GB:FROM 450979 GB:TO 452049 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53377.1 LENGTH 356 SQ:AASEQ MARVSIPVKALQKTGPDAPFEVKIIERRDPRADDVVIDIKAAGICHSDIHTIRNEWGEAHFPLTVGHEIAGVVSAVGTGVTKWKVGDRVGVGCLVNSCGECEQCVAGFENNCLRGNVGTYNSDDVDGTITQGGYAEKVVVNERFLCSIPEELDFDVAAPLLCAGITTYSPIARWNVKEGDKVAVMGLGGLGHMGVQIAAAKGADVTVLSRSLRKAELAKELGAARTLATSDEDFFTEHAGEFDFILNTISASIPVDKYLSLLKPHGVMAVVGLPPEKQPLSFGALIGGGKVLTGSNIGGIPETQEMLDFCAKHGLGAMIETVGVNDVDAAYDRVVAGDVQFRVVIDTASFAEVEAV GT:EXON 1|1-356:0| BL:SWS:NREP 1 BL:SWS:REP 9->349|ADHA_BACSU|8e-92|54.0|341/349| PROS 66->80|PS00059|ADH_ZINC|PDOC00058| SEG 70->81|agvvsavgtgvt| SEG 184->195|vmglgglghmgv| BL:PDB:NREP 1 BL:PDB:REP 8->346|1uufA|7e-68|46.2|331/339| RP:PDB:NREP 1 RP:PDB:REP 9->355|2cf5A|9e-55|34.8|345/352| RP:PFM:NREP 2 RP:PFM:REP 32->140|PF08240|5e-12|42.0|100/108|ADH_N| RP:PFM:REP 196->305|PF00107|3e-10|41.1|107/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 33->147|PF08240|1.7e-33|48.1|106/109|ADH_N| HM:PFM:REP 189->311|PF00107|7.7e-25|35.8|123/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 3 RP:SCP:REP 8->177|1uufA1|6e-31|34.7|167/178|b.35.1.2| RP:SCP:REP 155->315|1piwA2|2e-51|29.8|161/168|c.2.1.1| RP:SCP:REP 318->351|1uufA1|1e-04|35.3|34/178|b.35.1.2| HM:SCP:REP 8->195|1p0fA1|2.5e-54|47.7|176/0|b.35.1.2|1/1|GroES-like| HM:SCP:REP 152->316|1q1nA2|9.7e-46|40.0|165/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 3313 OP:NHOMOORG 863 OP:PATTERN 111-1-28899A7877143212--5---2132----------------1-11----11---4221-32 425-231444321247544-48338E43444756768CHE1534713112-1637333--114571A6541----------27-1111-----------1-2-2-31121--------------111---1-----14411---263332222--11----1-12-42211------------2-11111-524222223421233223644413224121-7-233333213-33333323433334112321-3--1-3---2233112111131111111111111211212222221111111111111211---111--1--4221222211143--1-----11--1-----1-2-1--111-1--25225222-----556673-43422333443343334-231-13-2223-88868598767A21122334----3244444444413321111------------------------------15122111226446456535577785555256772555--11711252312211221-1111-1-2222221442-2-1---1--------1211-211-338444211----111111111211111-----23111233327522211222232212222122---11--------4624134977A999A98-7988A999887A999899535456222446364744653433553355535--211111111111---211111333321-572225-1--111----223231511-5133333434333333233211111111-1222-----2211124323223334222---3111111--------1--------21--1-------1---------1--11--21- --11864-21---13CEHEDCEDMLKF4425457777978787544ABDMFIUTCC78364659837667454495758764447642-5O8E2B2A78372696B-423A43334-1----1-21-C1AQ8-84722112--3221----1-3181363731211-125-23-825319323214CKOECD21SSLH4 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 355 STR:RPRED 99.7 SQ:SECSTR TTTTTccEEEEEEccTTccEEEEEEEcccccTTEEEEEEEEEEEcHHHHHHHTcTTTccccccccccEEEEEEEEEccccccccTTcEEEEccEEEcccccHHHHTTcGGGcTTcEEETTTcccTTcccccccccccEEEEGGGEEEccccccHHHHTGGGTHHHHHHHHHHHTcTTcTTEEEEEcccHHHHHHHHHHHHHTcEEEEEEccTTHHHHHTTcccccEEETTcHHHHHHcTTTEEEEEEccccccccHHHHTTEEEEEEEEEcccccccccccHHHHHHHTcEEEEcccccHHHHHHHHHHHHHTTccccEEEEEGGGHHHHHHHHHTTccccEEEEETTccccccc# DISOP:02AL 1-6,355-357| PSIPRED ccccccEEEEEEEEcccccEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEcccccccccEEccccccEEEEEEcccccccccccEEEEccccccccccHHHccccccccccccccccccccccccccccccEEEEEEcHHHEEEccccccHHHHHccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccEEEEcccHHHHHHccccccEEEEccccHHHHHHHHHHHccccEEEEEcccccccEEcHHHHHHccEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHccccEEEEEEEEccccccccc //