[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53390.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   93->142 3c7nA PDBj 4e-04 18.0 %
:HMM:PFM   112->135 PF10925 * DUF2680 3.6e-05 54.2 24/59  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53390.1 GT:GENE BAF53390.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(465346..465837) GB:FROM 465346 GB:TO 465837 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53390.1 LENGTH 163 SQ:AASEQ MQNITRKIAALAIAGTLILPATAHAQSNFSAGSSSFDFGSSGPEEPQVEPLEVRLEVAYERLIAANGHVLHADQELEATGLLNRAFAGEFEFVDGKFYVYDEEKLTEYWIDLLTEEQAEEILDNIEADIKWAEENPEDSDKEFGLEVGKLGDYYYIAGVETYV GT:EXON 1|1-163:0| TM:NTM 1 TM:REGION 8->25| SEG 8->23|iaalaiagtlilpata| SEG 27->42|snfsagsssfdfgssg| RP:PDB:NREP 1 RP:PDB:REP 93->142|3c7nA|4e-04|18.0|50/649| HM:PFM:NREP 1 HM:PFM:REP 112->135|PF10925|3.6e-05|54.2|24/59|DUF2680| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 30.7 SQ:SECSTR ############################################################################################HHHHHHHHHHHHHTTTcTTTcccTTTTTccccHHHHHHGGGcTTccccHH##################### DISOP:02AL 1-4,32-42,44-45,138-138| PSIPRED ccHHHHHHHHHHHccEEEEEccccccccccccccccccccccccccccccEEEEEEEEHHHHHHccccEEEccHHHHHHHcHHHHHcccEEEEccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHcccccccccEEEEEEEEEcc //