[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53391.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->154 PF02562 * PhoH 2e-05 37.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53391.1 GT:GENE BAF53391.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(466051..466533) GB:FROM 466051 GB:TO 466533 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53391.1 LENGTH 160 SQ:AASEQ MRNIVSTVAATIIASSLLLPTTAVTASAQSSFSSGTFDLGMSHDSDPVAVQLEKAFEDYGLSRGHSLDLNAEMRAELLLRSVIKGHTITRNGRYLQLDPASNTLSSVSTVTPKEIQDFLEGINGGERIATSYFSGAPFRFGVAVGVKSGTYYLVTTKFTN GT:EXON 1|1-160:0| RP:PFM:NREP 1 RP:PFM:REP 17->154|PF02562|2e-05|37.2|113/205|PhoH| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02562|IPR003714| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,5-5,160-161| PSIPRED ccHHHHHHHHHHHHHHHccccccccccccccccccEEEEccccccccEEEEEHHHHHHcccccccEEEccHHHHHHHHHHHHHcccEEEEccEEEEEccccccccccccccHHHHHHHHHccccccEEEHHHcccccEEEEEEEEEcccEEEEEEEEEcc //