[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53395.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   149->184 PF05901 * Excalibur 4e-06 50.0 %
:HMM:PFM   148->184 PF05901 * Excalibur 1.9e-15 40.5 37/37  
:HMM:PFM   70->126 PF03748 * FliL 0.00043 18.2 44/149  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53395.1 GT:GENE BAF53395.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(468140..468706) GB:FROM 468140 GB:TO 468706 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53395.1 LENGTH 188 SQ:AASEQ MTARVKMISMRKTIITMLATTAIAFSAISPVQAQTVDTDTDASVSSELSSGTSSGSSEDSEDSDLSNRDIIFGVAAIAAVGGLIAGGVHWAVQQRMIPNPLPGIIPNPPALAPQAPAPAPAPAPAPQAVAPQAVAPAPAPAPVQTNRTYKNCTEVWNVLGRSIRQGEPGYGTHLDRDRDGIGCESRPR GT:EXON 1|1-188:0| TM:NTM 2 TM:REGION 13->35| TM:REGION 68->90| SEG 13->24|tiitmlattaia| SEG 43->66|svsselssgtssgssedsedsdls| SEG 70->88|iifgvaaiaavggliaggv| SEG 98->144|pnplpgiipnppalapqapapapapapapqavapqavapapapapvq| RP:PFM:NREP 1 RP:PFM:REP 149->184|PF05901|4e-06|50.0|36/37|Excalibur| HM:PFM:NREP 2 HM:PFM:REP 148->184|PF05901|1.9e-15|40.5|37/37|Excalibur| HM:PFM:REP 70->126|PF03748|0.00043|18.2|44/149|FliL| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------11111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,7-7,33-68,183-183,185-189| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccEEHHHHHcccccccccccHHHHcccccEEEHHHHHHHHccHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHcccccccccccccccc //