[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53399.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:82 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->73 3cuyA PDBj 2e-07 7.7 %
:RPS:SCOP  1->77 2iv7A1  c.87.1.8 * 3e-06 20.8 %
:RPS:PFM   1->46 PF00534 * Glycos_transf_1 2e-04 39.1 %
:HMM:PFM   1->49 PF00534 * Glycos_transf_1 4.4e-06 34.7 49/172  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53399.1 GT:GENE BAF53399.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 474507..474755 GB:FROM 474507 GB:TO 474755 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53399.1 LENGTH 82 SQ:AASEQ MANGIHITGVVKGETASLIKELNCGVVVDPEDPEALALSWKRLLNDRSQLQVSDTAREWVVTQRDEVVPQELYAFLSKLGIE GT:EXON 1|1-82:0| RP:PDB:NREP 1 RP:PDB:REP 9->73|3cuyA|2e-07|7.7|65/364| RP:PFM:NREP 1 RP:PFM:REP 1->46|PF00534|2e-04|39.1|46/165|Glycos_transf_1| HM:PFM:NREP 1 HM:PFM:REP 1->49|PF00534|4.4e-06|34.7|49/172|Glycos_transf_1| GO:PFM:NREP 1 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00534|IPR001296| RP:SCP:NREP 1 RP:SCP:REP 1->77|2iv7A1|3e-06|20.8|77/370|c.87.1.8| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 96.3 SQ:SECSTR HHTTccEETccEEEEHHHHcccTTEEEEcTTcHHHHHHHHHHHHHccccccccccHHHHHHHHGGGcGGGcccHHHHHH### DISOP:02AL 1-3| PSIPRED ccccEEEEEEEcccHHHHHHHccccEEEccccccHHHHHHHHHHccHHHEEEccHHHHHHHHHHccccHHHHHHHHHHHccc //