[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53405.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  472/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->171 1dbuA PDBj 5e-20 35.8 %
:RPS:PDB   18->170 1dbxA PDBj 6e-30 40.4 %
:RPS:SCOP  18->171 1dbuA  d.116.1.1 * 9e-39 39.2 %
:HMM:SCOP  18->169 1dbxA_ d.116.1.1 * 3.1e-36 35.8 %
:RPS:PFM   51->161 PF04073 * YbaK 2e-13 32.4 %
:HMM:PFM   49->158 PF04073 * YbaK 6.7e-26 33.6 110/123  
:BLT:SWISS 18->171 Y1434_HAEIN 6e-26 39.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53405.1 GT:GENE BAF53405.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 493385..493906 GB:FROM 493385 GB:TO 493906 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53405.1 LENGTH 173 SQ:AASEQ MQLKSGFMAKKVDTSNATPALALLTEKQIPFELDVHDVDPKSLKGFALDASEVMGVEPEVVFKTLMADIDGEHVVAIVPASSTLNLKQLAKAGKGKHANMMDRSRAQVVTGYVPGGISPIGQKNKHRVFLDESAILQDRIYVSAGRRGWSLIIAPDDVLLATDGVYADIADHS GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 18->171|Y1434_HAEIN|6e-26|39.2|153/158| BL:PDB:NREP 1 BL:PDB:REP 18->171|1dbuA|5e-20|35.8|148/150| RP:PDB:NREP 1 RP:PDB:REP 18->170|1dbxA|6e-30|40.4|146/150| RP:PFM:NREP 1 RP:PFM:REP 51->161|PF04073|2e-13|32.4|111/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 49->158|PF04073|6.7e-26|33.6|110/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 18->171|1dbuA|9e-39|39.2|148/152|d.116.1.1| HM:SCP:REP 18->169|1dbxA_|3.1e-36|35.8|151/157|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 473 OP:NHOMOORG 473 OP:PATTERN -------------------------------------------------------------------- 111-11-1111-1-1------11111-----111111111----11-11---11111---1111111111-11111111111------1111-111----------------------------------------1-------1----------------------111----------------------111111111111111111----11111--1-11111111111111111111111111111111-1--1-1111111--1--11-11111111111111111111111111111111111111--111---1-11-11111-1-1--11---1111--11111--11-1------------11--1111-----1-1--1-111-11--------------1--1-1----11111111111111-------------11111111-111-1-1-------------------------------11-11111---------------1------------1--11111-11-11-1-11-------1111111---11---1-1-11111--1--1-11111-111111--111-1----------------1-----11111-1111111111-1111111111111------1------11111111111111111-11111111-111111111111111-11111111111111111111111111--111111111111--------------1111111-1-11111---111111-11111-11111111111111111----------111111111111111111111111--------------------------------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 90.2 SQ:SECSTR ###############HHcHHHHHHHHHTcccEEEEcccccccccHcccHHHHHHTccGGGcEEEEEEEETTcTcEEEEEETTcccHHHHHHHHTTcccEEEcHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTEEEEEcHHHHHHHHTcEEEcccc## DISOP:02AL 1-8,173-174| PSIPRED cccccccccccHHHccccHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccHHHEEEEEEEEccccEEEEEEEcccEEcHHHHHHHHcccccEEccHHHHHHHHcccccccccccccccccEEEEHHHHccccEEEccccccEEEEEcHHHHHHHHccEEEEEEccc //