[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53409.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.15.4
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->232 1kf6B PDBj 1e-09 25.8 %
:RPS:PDB   1->242 2bs2B PDBj 6e-16 21.1 %
:RPS:SCOP  1->116 1kf6B2  d.15.4.2 * 7e-08 30.7 %
:RPS:SCOP  192->240 1e7pB1  a.1.2.1 * 9e-06 22.9 %
:HMM:SCOP  1->116 1nekB2 d.15.4.2 * 1.5e-20 39.8 %
:HMM:SCOP  116->245 1nekB1 a.1.2.1 * 2.2e-21 26.6 %
:HMM:PFM   155->173 PF00037 * Fer4 4.9e-10 68.4 19/24  
:HMM:PFM   51->72 PF00111 * Fer2 8.8e-05 36.4 22/77  
:BLT:SWISS 47->245 DHSB_BACSU 3e-10 26.3 %
:PROS 58->66|PS00197|2FE2S_FER_1
:PROS 159->170|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53409.1 GT:GENE BAF53409.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 498757..499506 GB:FROM 498757 GB:TO 499506 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53409.1 LENGTH 249 SQ:AASEQ MKLTLEIWRQAGPTAEGKFETVRVDDAVAQMSILELLDHVNNKFIEEGKEPFAFASDCREGICGTCGLLVNGRPHGADQNKPACAQRLVSYKEGDTLKIEPLRSAAYPVIKDMVVDRSALDRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACIGCGACVAACPNGAAHLFTGAKLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGECADVCPAGIPLTAVAAVTKERARAAFRGKDD GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 47->245|DHSB_BACSU|3e-10|26.3|186/253| PROS 58->66|PS00197|2FE2S_FER_1|PDOC00175| PROS 159->170|PS00198|4FE4S_FER_1|PDOC00176| SEG 157->169|aacigcgacvaac| BL:PDB:NREP 1 BL:PDB:REP 29->232|1kf6B|1e-09|25.8|190/243| RP:PDB:NREP 1 RP:PDB:REP 1->242|2bs2B|6e-16|21.1|228/239| HM:PFM:NREP 2 HM:PFM:REP 155->173|PF00037|4.9e-10|68.4|19/24|Fer4| HM:PFM:REP 51->72|PF00111|8.8e-05|36.4|22/77|Fer2| RP:SCP:NREP 2 RP:SCP:REP 1->116|1kf6B2|7e-08|30.7|101/105|d.15.4.2| RP:SCP:REP 192->240|1e7pB1|9e-06|22.9|48/133|a.1.2.1| HM:SCP:REP 1->116|1nekB2|1.5e-20|39.8|103/106|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 116->245|1nekB1|2.2e-21|26.6|128/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 123 OP:NHOMOORG 116 OP:PATTERN -------------------------------------------------------------------- 111-1111111111-----------------------1---111---1-------2----1112---1111----------1----1-11111111---112111111-2---------------11111-111--11111---1--1-------11111------------11----1------------1-----------------1---------11-----------1--------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------11-11----------111111111221211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1111111111------------------111111----------------------------------------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 98.4 SQ:SECSTR EEEEEEEccTTcTTcccEEEEEEEEcccTTccHHHHHHHHHHEEEEHTcTTcccccccccccccTTEEEETTEETTccccEEGGTGccGGGcTTcEEEEEccTTTccEEEETTEEEcHHHHHHHHHHTTccccccccccTTcccccccHHHHHHHTcccccHHHHTcHHHHHcTTccHHHHHHHHHHHHTcTTccccHHHHHHHHccTTGGGcccccHHHHHcTTcccHHHHHHHHHHHHTTccE#### DISOP:02AL 133-152,247-250| PSIPRED cEEEEEEEcccccccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccEEccccccccccccEEEEccEEccccccccEEEEEHHHccccccEEEEEcccccccEEEcccccccHHHHHHHccccEEcccccccccccccccHHHHHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHHcccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHcccc //