[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53418.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  606/915 : Eukaryota  96/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:549 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   255->358 3b8eA PDBj 3e-04 14.9 %
:RPS:SCOP  65->208 1pw4A  f.38.1.1 * 3e-11 10.4 %
:HMM:SCOP  1->224 1pw4A_ f.38.1.1 * 1.1e-49 31.2 %
:HMM:SCOP  226->549 1pw4A_ f.38.1.1 * 2.6e-36 30.7 %
:RPS:PFM   65->203,287->354 PF07690 * MFS_1 2e-16 33.1 %
:HMM:PFM   54->447 PF07690 * MFS_1 1.4e-59 30.4 345/353  
:BLT:SWISS 66->540 YUSP_BACSU 2e-45 26.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53418.1 GT:GENE BAF53418.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 506417..508066 GB:FROM 506417 GB:TO 508066 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53418.1 LENGTH 549 SQ:AASEQ MTSQVKPEDERPVTTISKSGAPSAHTSAPYGEAATKEAVEEKTTGRVGFIIAALMLAMLLSSLGQTIFGSALPTIVGELGGVNHMTWVITAFLLGQTISLPIFGKLGDQFGRKYLFMFAIALFVVGSIIGALAQNMTTLIVARALQGIAGGGLMILSQAITADVTTARERAKYMGIMGSVFGLSSILGPLLGGWFTDGPGWRWGLWLNVPIGIIALVAIAVLLKLPARERGKVSVDWLGSIFMAIATTAFVLAVTWGGNEYEWASPMIIGLFITTLVAAIVFVFVEKRAVDPLVPMGLFSNRNFVLTAVAGIGVGLFMMGTIAYMPTYLQMVHGLNPTQAGLMLIPMMIGLIGTSTVVGNIVSKTGKYKWYPFIGMLIMILALVLLSTLTPSASLALIGLYFFVFGFGLGCAMQILVLIVQNSFPITMVGTATGSNNFFRQIGGSVGSALIGGLFISNLSDRFTENVPAAVASMGEEGAQYASAMSDFSGASNLTPHLVESLPQALREAIQLSYNDALTPIFLALTPIAVVAAILLFFIREDHLKETHE GT:EXON 1|1-549:0| BL:SWS:NREP 1 BL:SWS:REP 66->540|YUSP_BACSU|2e-45|26.4|473/541| TM:NTM 14 TM:REGION 52->74| TM:REGION 86->108| TM:REGION 114->136| TM:REGION 141->163| TM:REGION 174->196| TM:REGION 207->228| TM:REGION 235->256| TM:REGION 264->286| TM:REGION 297->319| TM:REGION 339->361| TM:REGION 379->401| TM:REGION 413->435| TM:REGION 440->462| TM:REGION 519->541| SEG 32->44|eaatkeaveektt| SEG 52->63|aalmlamllssl| SEG 182->193|glssilgpllgg| SEG 209->227|vpigiialvaiavllklpa| SEG 376->410|mlimilalvllstltpsaslaliglyffvfgfglg| RP:PDB:NREP 1 RP:PDB:REP 255->358|3b8eA|3e-04|14.9|101/998| RP:PFM:NREP 1 RP:PFM:REP 65->203,287->354|PF07690|2e-16|33.1|205/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 54->447|PF07690|1.4e-59|30.4|345/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 65->208|1pw4A|3e-11|10.4|144/434|f.38.1.1| HM:SCP:REP 1->224|1pw4A_|1.1e-49|31.2|199/447|f.38.1.1|1/2|MFS general substrate transporter| HM:SCP:REP 226->549|1pw4A_|2.6e-36|30.7|264/447|f.38.1.1|2/2|MFS general substrate transporter| OP:NHOMO 3969 OP:NHOMOORG 740 OP:PATTERN 11----5344444452-211---1--------1-21--1111-484231-321----11-1222---- 3154R22766645164599-9622A788888573339EEE3E9C82523852988414--9562746HID2----211--3-411111221--1-----1-31--5-1-1--------------111111-1111-66654211431--1----------------1--2-------------3461---273B7787899A59A899961875988843443425455549M344444444444444655354572AA235249A4475537535532--------22------------------------------1--1---471111111-1133661332-----2--2-453231--331------11183331112-32845424552422244244344A-223226263C--F555AD3EFD3344111-1-111111-5555555531123214------------------------------1343355225GHIFIFBA89ACCKIAAAA6BKAM7A6D--658-233351115111---11321111111---212-14-112-111--2-1-12112-1221261-2------------1---------11-7733312---2-212222112333-1111-111------------45542833333344434-33333343333433333336B74765422-2222222122221B33143422-322222222222----442531111--323---122-22-1---14444412--1--444468582566415761111111111222233333111111144544322---------------------------------------------------1--------111 ----11-------14JHUDONRTgkjXJGGKIKYYKIKGIFINDCBWHGXTUmVFHKLKBDD465155351-6392222115674586-EE3H4B58568927888---------------------------------------------------------------------------------1-U----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 18.4 SQ:SECSTR ##############################################################################################################################################################################################################################################################HHHHTTTTTcccccHHHHHHHHHHHHHHHHHHccccccccTTcccccHHHHH#HHHHHHHHHHHHHHcTTGGGcccc#cccTTTT#TTTTHHHHHHHHHHHHHH############################################################################################################################################################################################### DISOP:02AL 1-45,483-496,542-542,545-550| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcc //