[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53422.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  264/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->94 2hh7A PDBj 7e-11 38.0 %
:RPS:PFM   12->90 PF02583 * DUF156 1e-16 59.7 %
:HMM:PFM   13->97 PF02583 * DUF156 8.1e-32 48.8 84/85  
:BLT:SWISS 9->100 CSOR_BACSU 2e-20 48.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53422.1 GT:GENE BAF53422.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(512499..512801) GB:FROM 512499 GB:TO 512801 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53422.1 LENGTH 100 SQ:AASEQ MSNSECHTHGYIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVAFGLLDDHLAHCVKEAADLGGDELDAKLKEVSDAIARFSKA GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 9->100|CSOR_BACSU|2e-20|48.9|90/101| BL:PDB:NREP 1 BL:PDB:REP 14->94|2hh7A|7e-11|38.0|79/85| RP:PFM:NREP 1 RP:PFM:REP 12->90|PF02583|1e-16|59.7|77/84|DUF156| HM:PFM:NREP 1 HM:PFM:REP 13->97|PF02583|8.1e-32|48.8|84/85|DUF156| OP:NHOMO 328 OP:NHOMOORG 266 OP:PATTERN --------------------------------11---------------------------------- ----11-111111111211-14113111111122431222111121112111211111--113111111111---11111211-1-----------------------1---------------------------111-----11-11-11111---------1111111-------------11--11-221111111211112121111111111212222111111131-111-1111111111111111----------------------------1-------------------------------11---111--22121112221121-133-1113--111111-5412-11211111----11-1--1-------11221111111----------1-211-112-----------------11-21---------------------1----------------------------------1------------------------------------------------------------11---------1----1--------1----1-1---11121-1--1-1-----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------111111111-------------------------------------11-------------------------------------1111-------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 79.0 SQ:SECSTR #############HHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTcccTTHHH##HHHHHHHHTT###### DISOP:02AL 1-16,74-87| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcc //