[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53440.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  861/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->231 2oqrA PDBj 4e-90 72.0 %
:RPS:PDB   3->104 3b8mC PDBj 4e-21 11.8 %
:RPS:PDB   133->231 2d1vA PDBj 1e-27 40.4 %
:RPS:SCOP  4->104 1a0oA  c.23.1.1 * 7e-23 31.7 %
:RPS:SCOP  133->231 1gxpA  a.4.6.1 * 4e-28 35.7 %
:HMM:SCOP  1->120 1zgzA1 c.23.1.1 * 2e-38 45.0 %
:HMM:SCOP  127->233 1ys7A1 a.4.6.1 * 3.2e-31 46.2 %
:RPS:PFM   4->103 PF00072 * Response_reg 5e-13 43.0 %
:RPS:PFM   154->229 PF00486 * Trans_reg_C 1e-14 47.4 %
:HMM:PFM   154->230 PF00486 * Trans_reg_C 6e-30 46.8 77/77  
:HMM:PFM   4->112 PF00072 * Response_reg 5.2e-28 37.6 109/112  
:BLT:SWISS 1->231 REGX3_MYCS2 2e-90 72.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53440.1 GT:GENE BAF53440.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 532265..532963 GB:FROM 532265 GB:TO 532963 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53440.1 LENGTH 232 SQ:AASEQ MTTILIVEDEESLADPLAFLLRKEGFDTIIAGDGPTALVEFSRNEIDIVLLDLMLPGMSGTDVCKELRSVSTVPVIMVTARDSEIDKVVGLELGADDYVTKPYSSRELIARIRAVLRRRGVTETEAEELPLDDQILEGGRVRMDVDSHTVTVDGEPVSMPLKEFDLLEYLLRNAGRVLTRGQLIDRIWGADYVGDTKTLDVHVKRLRSKIEEEPSRPRYLVTVRGLGYKFEL GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 1->231|REGX3_MYCS2|2e-90|72.2|227/228| SEG 106->119|reliariravlrrr| BL:PDB:NREP 1 BL:PDB:REP 2->231|2oqrA|4e-90|72.0|225/226| RP:PDB:NREP 2 RP:PDB:REP 3->104|3b8mC|4e-21|11.8|102/255| RP:PDB:REP 133->231|2d1vA|1e-27|40.4|99/103| RP:PFM:NREP 2 RP:PFM:REP 4->103|PF00072|5e-13|43.0|100/111|Response_reg| RP:PFM:REP 154->229|PF00486|1e-14|47.4|76/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 154->230|PF00486|6e-30|46.8|77/77|Trans_reg_C| HM:PFM:REP 4->112|PF00072|5.2e-28|37.6|109/112|Response_reg| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 4->104|1a0oA|7e-23|31.7|101/128|c.23.1.1| RP:SCP:REP 133->231|1gxpA|4e-28|35.7|98/103|a.4.6.1| HM:SCP:REP 1->120|1zgzA1|2e-38|45.0|120/0|c.23.1.1|1/1|CheY-like| HM:SCP:REP 127->233|1ys7A1|3.2e-31|46.2|106/0|a.4.6.1|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 12220 OP:NHOMOORG 896 OP:PATTERN ---------------------------2-5-2---1--1111144-1C-7524--------------- 9PT7S466778655CDDCC-CL55BCCCCCCAJGIIBHIGBGGIAA688BB9DEH66811LJO6T8JRORB444465559IC723478GGcT-D22---66K5A7R9S9O----------11112422433484C3VVVXUI9GZ5rUhbTSAKJFG757A98ORGFnn*K574555664545EF699444B7IWWXWXUVXIXUYYWTHHECBEWXe9BDX8GFA99A9Ahb7AB9A99899AAA9979996B675CC655466677CC655675686DED766899988888898888555556666865598767476776TJLeQQQVUUVTSLEdWW9DFBRKI8BCHND4faMBA635557687328MH9EEEE56556GETNPFCDIOHINAA9AAAAA99D-IJNIKPJQCLA1PIIMKGKPRLIGEL8DEECJGBHHADBCCCCCCCCBEE8AUGD2232222211333322333334213222236BE56CHGCIRUXVbQNHHHEQQWZJIKJCLYQVMURV12NTQZGLFFcKLNS9KQKHDCDG91211111A86HSZCdfPB8WL9gREDH1jYlVYXgMMJGJJUjENF7895666666322422323GH8BE88KJAJKSQ9LJEOIOOLGNJRONLOMNOMSS--46B7C------GGEFDFCFGGHFHHIFG-GIGFGGGFGHGGGGGFGGDJIICF889FEFFFFFFEEFEFEFFGDDEDDEG91DGGGGGGGGGGG--2D343334544BHd9M444323244443115EDBCE8C9CCKLWUWWSaabLVYYXMPPS3212132128FKJNHHHHHLMROPRTIGKGHFFG7767--Z399446621121121312-------------------------48434666664L3 ----32--------3-----------1--------------------------------------------------------------------------1------2-------------------------------------------------3----2-1-------5-125-------3--C--11-A---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 232 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHcccEEETTEEEETTTTEEEETTEEccccHHHHHHHHHHHHTTTccccHHHHHHHHHcTTccccTHHHHHHHHHHHHHHcccTTccccEEEETTTEEEEcc DISOP:02AL 119-133| PSIPRED ccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEcccccHHHHHHHHHHHHHHccccccccccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHcccccccccEEEEEcccEEEEEc //