[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53449.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->24 PF08179 * SspP 0.00055 29.2 24/45  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53449.1 GT:GENE BAF53449.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(541193..541375) GB:FROM 541193 GB:TO 541375 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53449.1 LENGTH 60 SQ:AASEQ MSTKNTSKTPQQNPKIIMPGEQTEKPLYVTFGGVIRELRGEVFAVVESSQPRRRRSPGTR GT:EXON 1|1-60:0| HM:PFM:NREP 1 HM:PFM:REP 1->24|PF08179|0.00055|29.2|24/45|SspP| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15,48-61| PSIPRED cccccccccccccccEEEccccccccEEEEHHHHHHHHHccEEEEEEccccHHHcccccc //