[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53453.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->12 PF11475 * VP_N-CPKC 0.00023 87.5 8/32  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53453.1 GT:GENE BAF53453.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(543138..543296) GB:FROM 543138 GB:TO 543296 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53453.1 LENGTH 52 SQ:AASEQ MAHGCAHSLTFRYPSRAYPPRKLYHGYDTQWRYPLSVWRLCAHEPGRFLFVS GT:EXON 1|1-52:0| HM:PFM:NREP 1 HM:PFM:REP 5->12|PF11475|0.00023|87.5|8/32|VP_N-CPKC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccEEEEEccccccccHHHHccccccEEccHHHHHHHHcccccEEEEc //