[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53471.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->155 PF07690 * MFS_1 1.6e-06 21.9 114/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53471.1 GT:GENE BAF53471.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 561931..562443 GB:FROM 561931 GB:TO 562443 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53471.1 LENGTH 170 SQ:AASEQ MPSMFPSPATGGDDINRRPLNEPNADATTIPTALKVVFWMLFATAAFMIFTGLVMYTAGYTGPDDVDESYKAVVVNNQEFIGGINAFAGIVIAALTSQLPKGGKNPRRLLLAIMLLVLLTDLLSFATRAGGFALAIIAVLLALEALLMFRPAVNDHIDRNHMARVMNREK GT:EXON 1|1-170:0| TM:NTM 3 TM:REGION 33->55| TM:REGION 109->131| TM:REGION 133->155| SEG 109->123|lllaimllvlltdll| SEG 129->147|aggfalaiiavllaleall| HM:PFM:NREP 1 HM:PFM:REP 35->155|PF07690|1.6e-06|21.9|114/353|MFS_1| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,8-20,164-171| PSIPRED ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcc //