[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53480.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  396/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
:337 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   173->326 PF01578 * Cytochrom_C_asm 3e-24 43.7 %
:HMM:PFM   123->331 PF01578 * Cytochrom_C_asm 1e-41 33.5 206/214  
:HMM:PFM   89->152 PF07086 * DUF1352 0.00099 18.8 64/186  
:BLT:SWISS 112->337 CCSA_GUITH 2e-33 34.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53480.1 GT:GENE BAF53480.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 572923..573936 GB:FROM 572923 GB:TO 573936 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53480.1 LENGTH 337 SQ:AASEQ MLPVNQTYAQFSDTAFVSAYIIYVLALILSLVYYVKQQGIIDARREQTRVSELVGAGGSADVDTDLPDDIADGVLADEDLAKREETARKLANMTQSLMWLGVMAHLVSVVMRALSASRFPFGNLYEYILMVTLFAMIGAVLILQRPQFRVVWPWILTPMLALLFYGGTQLYSDAAPVVPALQSFWFPIHVSSVSIGASIGIVSGIASLLYLLRMWQPKGKEKGFFGAVAKPLPSGKTLDNLAYKTAIWTVPIFGLGIILGAIWAEAAWGRFWGWDPKETVSFITWVLYAGYLHARATAGWRNTNAAWINILALVTMIFNLFFINMVVSGLHSYAGLN GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 112->337|CCSA_GUITH|2e-33|34.5|226/301| TM:NTM 8 TM:REGION 12->34| TM:REGION 95->117| TM:REGION 124->146| TM:REGION 153->175| TM:REGION 189->211| TM:REGION 245->267| TM:REGION 277->294| TM:REGION 306->328| SEG 190->207|vssvsigasigivsgias| RP:PFM:NREP 1 RP:PFM:REP 173->326|PF01578|3e-24|43.7|151/212|Cytochrom_C_asm| HM:PFM:NREP 2 HM:PFM:REP 123->331|PF01578|1e-41|33.5|206/214|Cytochrom_C_asm| HM:PFM:REP 89->152|PF07086|0.00099|18.8|64/186|DUF1352| GO:PFM:NREP 3 GO:PFM GO:0006461|"GO:protein complex assembly"|PF01578|IPR002541| GO:PFM GO:0008535|"GO:respiratory chain complex IV assembly"|PF01578|IPR002541| GO:PFM GO:0016020|"GO:membrane"|PF01578|IPR002541| OP:NHOMO 507 OP:NHOMOORG 405 OP:PATTERN -----------------------1-------------------------------------------- -21-111111111111111-131111111111212211111111211111112141111111211111111------------111122241-211---1211121------------------1111111111-1----------211111111111111111111111111111111111111-------111111111111111111111111111112111------111------------------------------------------------------------------------------------------11-------------------------2--1-11-1-1-2-1--------21111-1------------------------------------------------111----111-111111111---------------1--------1--------------------1---1-1111211111111111111111111115211111111111111111-1111-1111111111111-1----12222112211111155536662244341-22121111122121111111111211111------1--------------------------11-1------1---1-11111111111-1111111111111111111111---------------------11111111--111111111111--------------1--1-----------------------1-----------------------------1------------------------------------------------------------------------------------132 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1811---11-5---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,43-44,47-53,55-59,82-84| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //