[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53488.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->103 PF06699 * PIG-F 7.3e-06 25.6 78/191  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53488.1 GT:GENE BAF53488.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 580448..580801 GB:FROM 580448 GB:TO 580801 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53488.1 LENGTH 117 SQ:AASEQ MSRVEYVSESNTPNIQTHQAPELNPELQKAARKNVLIYGLARLLLFVVLTLIIHGLALLISAPVPLVMSAMLALIVAFPLSMLVFSKLRMNATQAVSQWDAQRKAHKEWVRSELADR GT:EXON 1|1-117:0| TM:NTM 2 TM:REGION 35->57| TM:REGION 66->87| SEG 40->51|larlllfvvltl| HM:PFM:NREP 1 HM:PFM:REP 24->103|PF06699|7.3e-06|25.6|78/191|PIG-F| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------1111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-8,13-27,115-118| PSIPRED ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //