[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53507.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.23.14
:223 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  50->141 1s2dA  c.23.14.1 * 2e-11 18.7 %
:RPS:PFM   8->146 PF11071 * DUF2872 6e-55 71.9 %
:HMM:PFM   8->146 PF11071 * DUF2872 5.8e-69 66.9 139/141  
:BLT:SWISS 3->149 YTOQ_BACSU 1e-30 40.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53507.1 GT:GENE BAF53507.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 599297..599968 GB:FROM 599297 GB:TO 599968 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53507.1 LENGTH 223 SQ:AASEQ MALSFNVYLSGEIHTDWREEIQRGAEAAGLDVVFTAPVTDHPASDAAGDHLGEAPAGFWRDHQSSKVNSIRTRSLIEKADMVVVRFGDQYKQWNAAFDAGYCAALDKPYATLHGEDIVHPLKEVDAAAQAGCTTTDQVVEILRYMLEAEEALLSCASPLSRQAQRHGEPTLSPRPEFHRTAVGFRNCIDDRQPQALACPRGPLRPCEGLHPRADLRRVQLRPT GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 3->149|YTOQ_BACSU|1e-30|40.1|147/100| RP:PFM:NREP 1 RP:PFM:REP 8->146|PF11071|6e-55|71.9|139/141|DUF2872| HM:PFM:NREP 1 HM:PFM:REP 8->146|PF11071|5.8e-69|66.9|139/141|DUF2872| RP:SCP:NREP 1 RP:SCP:REP 50->141|1s2dA|2e-11|18.7|91/165|c.23.14.1| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------1--2--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111111-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----111---------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------1-------------------------11-----------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,160-171,222-224| PSIPRED cccEEEEEEEEccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHcEEEEcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEccc //