[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53512.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   70->143 3d36A PDBj 3e-04 14.9 %
:RPS:PFM   16->42 PF03050 * Transposase_25 6e-04 51.9 %
:HMM:PFM   17->73 PF10551 * MULE 0.00019 29.6 54/93  
:BLT:SWISS 17->77 Y4551_YERPS 5e-10 44.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53512.1 GT:GENE BAF53512.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 603726..604178 GB:FROM 603726 GB:TO 604178 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53512.1 LENGTH 150 SQ:AASEQ MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPQTVEHWQVKYLNNVIEGDHGRLKRILGLKGAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 17->77|Y4551_YERPS|5e-10|44.3|61/107| RP:PDB:NREP 1 RP:PDB:REP 70->143|3d36A|3e-04|14.9|74/217| RP:PFM:NREP 1 RP:PFM:REP 16->42|PF03050|6e-04|51.9|27/160|Transposase_25| HM:PFM:NREP 1 HM:PFM:REP 17->73|PF10551|0.00019|29.6|54/93|MULE| OP:NHOMO 228 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- --3---25469--4----------------------------------------------------------------------------------5-------------------------------------------------1-----------------------------------------------------1-1--------------4-------8-------2-------------------8-----------------------C3-------------------------------------2234------------------------------------------------------------------------------2221222122----6--62-----1--3---1---------1------1----------1-1---------------------------------4---1---------------------1-------------------------3---------------------1---------------------------------------------------------------------------------------------------------------------1-2------29---2---4------D1-----------9--3--3---A------------------------1------------------------------3-3-3---------2------------------------1--5--------------4-------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------6--------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 49.3 SQ:SECSTR #####################################################################EEEEEETTEEEEEEEEccccccHHHHHHTTcTTccccGGGccccHHHHHHHHHHHTTcEEEEEETTTEEEEEEE####### DISOP:02AL 1-5,146-151| PSIPRED ccccccccccccEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHccccccccEEEEEEccccHHccccHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHHccccccccccccccccc //