[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53533.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  35/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->53 PF03050 * Transposase_25 5e-05 40.0 %
:HMM:PFM   2->53 PF03050 * Transposase_25 1.5e-07 27.5 51/178  
:BLT:SWISS 3->53 T431_STAAW 3e-08 47.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53533.1 GT:GENE BAF53533.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 623775..623936 GB:FROM 623775 GB:TO 623936 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53533.1 LENGTH 53 SQ:AASEQ MPVDHPTIYRWVQKYAPELDKQTRRYRQVPDWQASSWRVDETYIRVGGKRCYL GT:EXON 1|1-53:0| BL:SWS:NREP 1 BL:SWS:REP 3->53|T431_STAAW|3e-08|47.9|48/224| RP:PFM:NREP 1 RP:PFM:REP 3->53|PF03050|5e-05|40.0|50/160|Transposase_25| HM:PFM:NREP 1 HM:PFM:REP 2->53|PF03050|1.5e-07|27.5|51/178|Transposase_25| OP:NHOMO 122 OP:NHOMOORG 37 OP:PATTERN ---------------------------------------------------1---------------- --3---24456--2------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1----------------4------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------------1------1----------1-1-------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2------29---2---4------E1-----------9--3--3---A------------------------1------------------------------3-3-3---------2------------------------------------------4-------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------6------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEccEEEEc //