[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53542.1
DDBJ      :             hypothetical protein
Swiss-Prot:UBIE_CORGB   RecName: Full=Menaquinone biosynthesis methyltransferase ubiE;         EC=2.1.1.-;

Homologs  Archaea  21/68 : Bacteria  742/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->155 1xxlA PDBj 1e-09 31.4 %
:RPS:PDB   34->223 3bkwA PDBj 4e-29 16.8 %
:RPS:SCOP  17->216 2gh1A1  c.66.1.49 * 1e-25 12.9 %
:HMM:SCOP  1->229 1xvaA_ c.66.1.5 * 1.6e-45 31.0 %
:RPS:PFM   13->227 PF01209 * Ubie_methyltran 2e-49 46.0 %
:HMM:PFM   13->227 PF01209 * Ubie_methyltran 3.6e-62 39.1 215/233  
:BLT:SWISS 1->230 UBIE_CORGB e-133 100.0 %
:PROS 24->39|PS01183|UBIE_1
:PROS 135->149|PS01184|UBIE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53542.1 GT:GENE BAF53542.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 632427..633119 GB:FROM 632427 GB:TO 633119 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53542.1 LENGTH 230 SQ:AASEQ MAKADLDKDPFDVASMFDDVGKNYDLTNTVLSFGQDRVWRKRTRQRLDLKPGEKVLDLAAGTAVSTVELAKSGAFCVACDFSQGMLAAGKDRDVSKVVGDGMQLPFADNSFDAVTISYGLRNIHDFRAGLKEMARVTKPGGRLTVAEFSTPVIPVFGTVYKEYLMRLLPQVARAVSSNPEAYIYLADSIRAWPSQAELAREINQNGWSDCGWQNLTFGIVALHSAIKPEN GT:EXON 1|1-230:0| SW:ID UBIE_CORGB SW:DE RecName: Full=Menaquinone biosynthesis methyltransferase ubiE; EC=2.1.1.-; SW:GN Name=ubiE; OrderedLocusNames=cgR_0574; SW:KW Complete proteome; Menaquinone biosynthesis; Methyltransferase;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|UBIE_CORGB|e-133|100.0|230/230| GO:SWS:NREP 3 GO:SWS GO:0009234|"GO:menaquinone biosynthetic process"|Menaquinone biosynthesis| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 24->39|PS01183|UBIE_1|PDOC00911| PROS 135->149|PS01184|UBIE_2|PDOC00911| BL:PDB:NREP 1 BL:PDB:REP 54->155|1xxlA|1e-09|31.4|102/231| RP:PDB:NREP 1 RP:PDB:REP 34->223|3bkwA|4e-29|16.8|190/215| RP:PFM:NREP 1 RP:PFM:REP 13->227|PF01209|2e-49|46.0|215/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 13->227|PF01209|3.6e-62|39.1|215/233|Ubie_methyltran| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 17->216|2gh1A1|1e-25|12.9|186/281|c.66.1.49| HM:SCP:REP 1->229|1xvaA_|1.6e-45|31.0|229/292|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1202 OP:NHOMOORG 943 OP:PATTERN ------111------1-11----1111----1---------------1-131-----2-1--111-1- 1232211122211112111-121121111112244421221111221121211121111112311112211--------1111--1-11111-111--1111111111111111111111111111111111111111122232211122111111111111-111112221-11111-111121111---11111111111111111111111111111111111111112211111111111111111111--1----12-21111-----11--11------------------------------------------------1------------11---------1--1211111---12--1--1-111111111111122111112111111111111111-3222221121111111111121111111111112111111111111121121111111111111111111111111111111111111111111211111111111111122211121122111122112111112221112211121111111111112111411111121111111111111111112312211111111111111111111111111111212111111111111111111111111--12221------22211211222122222-21122222222222212222221111121222222221222222211112111111111111111111111111111121111111-1-1----11111111111111131111113111111111111111111112112222221222211111111111111111-111111-----------------------------------------1-111111 11-111--311--11121111111111111111111-1111111-1111111111111111111111111111111111111112111-22121111111111112--2121211111-11121221-14C2-11211112112211-1-21-1132121--11111111-11112223Q3432231221422222112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 99.6 SQ:SECSTR TTccTTEEEEcTTccEcccHHHHHHHHHHHHTccGGGcTTHHHHHHccccTTcEEEEETcTTcHHHHHHHHTTccEEEEEEccHHHHHcccccEEEEEccGGGccccTTcEEEEEEEccGGGcccHHHHHHHHHHHEEEEEEEEEEEEcHHHHccccccEEcTTccEEcccccTTccEEEcTTHHHHcccEEccHHHHHHHHHHTTcEEEEEEEccccHHHHHTcEEEH# DISOP:02AL 1-1,3-5,230-231| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccEEEEEEEcccEEEEEEEEcccc //