[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53547.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL11_CORGB   RecName: Full=50S ribosomal protein L11;

Homologs  Archaea  10/68 : Bacteria  909/915 : Eukaryota  127/199 : Viruses  0/175   --->[See Alignment]
a.4.7d.47.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->144 2zjpF PDBj 1e-33 48.9 %
:RPS:PDB   1->143 3bboK PDBj 1e-34 46.2 %
:RPS:SCOP  12->71 1mmsA2  d.47.1.1 * 2e-21 70.0 %
:RPS:SCOP  87->143 1hc8A  a.4.7.1 * 5e-11 40.4 %
:HMM:SCOP  4->87 1wibA_ d.47.1.1 * 3.5e-29 50.0 %
:HMM:SCOP  70->143 1hc8A_ a.4.7.1 * 3.1e-27 64.9 %
:RPS:PFM   12->69 PF03946 * Ribosomal_L11_N 2e-16 69.0 %
:RPS:PFM   87->142 PF00298 * Ribosomal_L11 6e-05 42.9 %
:HMM:PFM   74->142 PF00298 * Ribosomal_L11 3.2e-33 65.2 69/69  
:HMM:PFM   12->69 PF03946 * Ribosomal_L11_N 1.2e-32 70.7 58/60  
:BLT:SWISS 1->144 RL11_CORGB 2e-58 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53547.1 GT:GENE BAF53547.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 639045..639479 GB:FROM 639045 GB:TO 639479 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53547.1 LENGTH 144 SQ:AASEQ MAPKKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGKVSMAQVREIAETKKEDLNARDIDAAAKIIAGTARSMGITVEG GT:EXON 1|1-144:0| SW:ID RL11_CORGB SW:DE RecName: Full=50S ribosomal protein L11; SW:GN Name=rplK; OrderedLocusNames=cgR_0579; SW:KW Complete proteome; Methylation; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|RL11_CORGB|2e-58|100.0|144/144| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 72->86|klktppaaklllkaa| SEG 121->136|ardidaaakiiagtar| BL:PDB:NREP 1 BL:PDB:REP 6->144|2zjpF|1e-33|48.9|139/144| RP:PDB:NREP 1 RP:PDB:REP 1->143|3bboK|1e-34|46.2|143/145| RP:PFM:NREP 2 RP:PFM:REP 12->69|PF03946|2e-16|69.0|58/60|Ribosomal_L11_N| RP:PFM:REP 87->142|PF00298|6e-05|42.9|56/69|Ribosomal_L11| HM:PFM:NREP 2 HM:PFM:REP 74->142|PF00298|3.2e-33|65.2|69/69|Ribosomal_L11| HM:PFM:REP 12->69|PF03946|1.2e-32|70.7|58/60|Ribosomal_L11_N| GO:PFM:NREP 6 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03946|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF03946|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF03946|IPR000911| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 2 RP:SCP:REP 12->71|1mmsA2|2e-21|70.0|60/63|d.47.1.1| RP:SCP:REP 87->143|1hc8A|5e-11|40.4|57/74|a.4.7.1| HM:SCP:REP 4->87|1wibA_|3.5e-29|50.0|82/0|d.47.1.1|1/1|Ribosomal L11/L12e N-terminal domain| HM:SCP:REP 70->143|1hc8A_|3.1e-27|64.9|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 1087 OP:NHOMOORG 1046 OP:PATTERN -----1-11111111--------1-------------------------------------------- 1111111111111111111-1111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111131111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------------1111111111111111111-1111-1-1111111111111111111111111-1111--1---11-111-----11-11111111111111112--3---1----1-1--1------------2111-11111--11-1--11--------1-1--11-11112112G222124113-12-131112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 100.0 SQ:SECSTR ccccccccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEcc DISOP:02AL 1-4,85-99| PSIPRED cccccccEEEEEEEEEEccccccccccHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEcccHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccEEEEc //