[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53564.1
DDBJ      :             hypothetical protein
Swiss-Prot:RS12_CORGL   RecName: Full=30S ribosomal protein S12;

Homologs  Archaea  35/68 : Bacteria  904/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->121 1vs5L PDBj 3e-49 75.6 %
:RPS:PDB   1->121 3bbnL PDBj 6e-49 73.6 %
:RPS:SCOP  2->121 1fjgL  b.40.4.5 * 3e-48 75.0 %
:HMM:SCOP  2->123 1fjgL_ b.40.4.5 * 2.1e-50 66.4 %
:RPS:PFM   3->121 PF00164 * Ribosomal_S12 5e-38 79.0 %
:HMM:PFM   2->121 PF00164 * Ribosomal_S12 8.4e-59 65.8 120/122  
:BLT:SWISS 1->122 RS12_CORGL 6e-67 100.0 %
:PROS 43->50|PS00055|RIBOSOMAL_S12

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53564.1 GT:GENE BAF53564.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 663122..663490 GB:FROM 663122 GB:TO 663490 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53564.1 LENGTH 122 SQ:AASEQ MPTIQQLVRKGRHDKSAKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDTQGVKDRKQARSRYGAKRG GT:EXON 1|1-122:0| SW:ID RS12_CORGL SW:DE RecName: Full=30S ribosomal protein S12; SW:GN Name=rpsL; OrderedLocusNames=Cgl0493, cg0581; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RS12_CORGL|6e-67|100.0|122/122| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 43->50|PS00055|RIBOSOMAL_S12|PDOC00054| BL:PDB:NREP 1 BL:PDB:REP 3->121|1vs5L|3e-49|75.6|119/123| RP:PDB:NREP 1 RP:PDB:REP 1->121|3bbnL|6e-49|73.6|121/123| RP:PFM:NREP 1 RP:PFM:REP 3->121|PF00164|5e-38|79.0|119/122|Ribosomal_S12| HM:PFM:NREP 1 HM:PFM:REP 2->121|PF00164|8.4e-59|65.8|120/122|Ribosomal_S12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00164|IPR006032| GO:PFM GO:0005622|"GO:intracellular"|PF00164|IPR006032| GO:PFM GO:0005840|"GO:ribosome"|PF00164|IPR006032| GO:PFM GO:0006412|"GO:translation"|PF00164|IPR006032| RP:SCP:NREP 1 RP:SCP:REP 2->121|1fjgL|3e-48|75.0|120/125|b.40.4.5| HM:SCP:REP 2->123|1fjgL_|2.1e-50|66.4|122/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1134 OP:NHOMOORG 1099 OP:PATTERN ----111111111111-------1---------11---1111------1111111111111111---- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111112-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111211111111111111111111111111111111111111111111111111111111111111111111111--111111111111111-11-111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---11111-11111111111111111111-111111111111111111111-111111111111111111111111121-11111111111111111-1--41211--1111-1111121323-111111111131-11-1111111111212111111-111141211--------3-8112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 99.2 SQ:SECSTR cccTTHHHHTcccccccccccccTTTcccEEEEEEEEEEEcccccccccEEEEEEEETTccEEEEEcccccccccTTcEEEEccccccccTTccEEccTTcTTccccTTcccccccTTccc# DISOP:02AL 7-7,10-23,109-123| PSIPRED cccHHHHHHccccccccccccccccccccccEEEEEEEEEcccccccccccEEEEEEccccEEEEEEcccccccccccEEEEEccccccccccEEEEEEEEHHccccccccccccccccccc //