[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53569.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:264 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->240 2nq2D PDBj 9e-28 34.1 %
:RPS:PDB   1->238 3dmdC PDBj 7e-41 12.0 %
:RPS:SCOP  3->237 1b0uA  c.37.1.12 * 3e-39 25.8 %
:HMM:SCOP  7->222 1ii8.1 c.37.1.12 * 2.3e-64 36.4 %
:RPS:PFM   29->69 PF02463 * SMC_N 4e-05 46.3 %
:RPS:PFM   44->169 PF00005 * ABC_tran 3e-13 36.1 %
:HMM:PFM   44->169 PF00005 * ABC_tran 1e-19 31.3 115/118  
:HMM:PFM   30->55 PF01637 * Arch_ATPase 9.6e-05 34.6 26/234  
:BLT:SWISS 5->246 YUSV_BACSU 5e-72 51.7 %
:PROS 141->155|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53569.1 GT:GENE BAF53569.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(669203..669997) GB:FROM 669203 GB:TO 669997 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53569.1 LENGTH 264 SQ:AASEQ MNNRLTMEDVTMAYDNRVIAEHLNVTIPDNTFTAIIGPNGCGKSTLLRGFSRVLNPQHGKVLLDGRQLDSFKPKEIARELGLLPQTSIAPEGIRVYDLIARGRAPYQSLIQQWRASDEDAVAQALASTNLTELAARLVDELSGGQRQRVWVAMLLAQQTPIMLLDEPTTFLDIAHQYELLELLRAFNEAGKTVVTVLHDLNQAARYADHLIVMKDGHVHATGTPEEVLTAEMVQGVFGLPCIISPDPVTGTPTVVPLSRSHAEA GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 5->246|YUSV_BACSU|5e-72|51.7|242/275| PROS 141->155|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 247->256|pvtgtptvvp| BL:PDB:NREP 1 BL:PDB:REP 1->240|2nq2D|9e-28|34.1|223/248| RP:PDB:NREP 1 RP:PDB:REP 1->238|3dmdC|7e-41|12.0|217/318| RP:PFM:NREP 2 RP:PFM:REP 29->69|PF02463|4e-05|46.3|41/536|SMC_N| RP:PFM:REP 44->169|PF00005|3e-13|36.1|122/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 44->169|PF00005|1e-19|31.3|115/118|ABC_tran| HM:PFM:REP 30->55|PF01637|9.6e-05|34.6|26/234|Arch_ATPase| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->237|1b0uA|3e-39|25.8|233/258|c.37.1.12| HM:SCP:REP 7->222|1ii8.1|2.3e-64|36.4|214/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 49451 OP:NHOMOORG 1173 OP:PATTERN TTMCSMJMXWXUWQaOnJQRKNNWuPSjmXhQI9ECDCHGGFDRZPXjMQ**f9TiUVZNTMKGX19B XYqL*cdgrrvbgVYRUPO-OkBBX*OPPOPOskml****U*Z*z*yjunhS**xQRiDDw**n*t****ebeeezdbcT*kkBADAAWWRK6PGJF--EHQJHGcMVMQ7877778BCBAAAAFVPLRZNLWTXSemmz*LKK*awfkrbZibgTUOGMLRJegcj***bJRHJGGEPFKFGhZZPMoiBbey************************gn***prxz*vuv**XjkmmmlemnkkjmmYdbYa*jad**cRcZhvtRS**gURZkmdghpotwws**xxuyvwuqvzqvxccdcccefgedcd*tphhitruon*x*********h*ir***bhhd*sjps*frUO**uhYedlWakdkkRZbZKdSRRKMMLLLfR***VRr****************-os*ki*o***QB**************HJJ**********RQRRRRRRoZfIShb*554554445567889A88987877984A4HBAFDH************vsur*****xzzf********9Ixvn*isnp******bihOXLSoTIJKIMJIPNRYidcw*PgXumVlsZZiKZeTVTTdXZUXSZpzXvJJKNEIIGJHEAABCBBBBBHRDEIQPtptPvUaIUJvSTWZUNXdVTTWVXabZYb6-FLUPM21-333*y**X**********zy-**zz*********vxzxwv*****jreqmklmoooopmmomlk*rmpuuuwV3************34JFBDBBCLMONLH*n*ZZYaZUHNQMLUPTdOQSQQHPKPXoeyzuyx***v****l***EDECEGEEDLmrq*qrrrr*****PRSPRQPQRRCCBC67LTOOGHHJ988988AA*BWCBABD-8BCADFAKNJBBLCCA99AZeqVSk*lkjAXN 3367gdI1bMACYfTHGJGGMTMXNaPIIDDCDOKL8HGHFHIGGEIEOQXTeXIILBEFEFF7B38C29D77DACD4CG98758C5B-KS9GHDEFC9CB6ENLI6Usn*XkYtdkKHGCKZIwuB*A**u3zawLILCnFLlUDSJGDhEA*GeXXuLo*PoReC*ah*debKHJID*9CDIJpjn*H*xOK*n*tS ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,257-257,259-265| PSIPRED ccccEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHccHHHHHHHccEEcccccccccccHHHHHHcccccHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHcHHHHHHHccccEEEEEcccccEEEEEEcccccccc //