[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53582.1
DDBJ      :             hypothetical protein
Swiss-Prot:RS19_CORGL   RecName: Full=30S ribosomal protein S19;

Homologs  Archaea  8/68 : Bacteria  902/915 : Eukaryota  74/199 : Viruses  0/175   --->[See Alignment]
d.28.1
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->92 3bbnS PDBj 3e-33 60.9 %
:RPS:PDB   1->92 3bbnS PDBj 9e-33 60.9 %
:RPS:SCOP  2->85 1fjgS  d.28.1.1 * 2e-31 66.7 %
:HMM:SCOP  2->85 1fjgS_ d.28.1.1 * 6e-32 56.0 %
:RPS:PFM   3->83 PF00203 * Ribosomal_S19 3e-28 67.9 %
:HMM:PFM   3->83 PF00203 * Ribosomal_S19 7.2e-40 60.5 81/81  
:BLT:SWISS 1->92 RS19_CORGL 2e-52 100.0 %
:PROS 53->77|PS00323|RIBOSOMAL_S19

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53582.1 GT:GENE BAF53582.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 678597..678875 GB:FROM 678597 GB:TO 678875 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53582.1 LENGTH 92 SQ:AASEQ MPRSLKKGPFVDEHLLNKVDAQNEKGTKQVIKTWSRRSTILPDFIGHTFAVHDGRKHVPVFVDDAMVGHKLGEFAPTKTFKGHVKDDKKGRR GT:EXON 1|1-92:0| SW:ID RS19_CORGL SW:DE RecName: Full=30S ribosomal protein S19; SW:GN Name=rpsS; OrderedLocusNames=Cgl0511, cg0599; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->92|RS19_CORGL|2e-52|100.0|92/92| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 53->77|PS00323|RIBOSOMAL_S19|PDOC00288| BL:PDB:NREP 1 BL:PDB:REP 1->92|3bbnS|3e-33|60.9|92/92| RP:PDB:NREP 1 RP:PDB:REP 1->92|3bbnS|9e-33|60.9|92/92| RP:PFM:NREP 1 RP:PFM:REP 3->83|PF00203|3e-28|67.9|81/81|Ribosomal_S19| HM:PFM:NREP 1 HM:PFM:REP 3->83|PF00203|7.2e-40|60.5|81/81|Ribosomal_S19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00203|IPR002222| GO:PFM GO:0005622|"GO:intracellular"|PF00203|IPR002222| GO:PFM GO:0005840|"GO:ribosome"|PF00203|IPR002222| GO:PFM GO:0006412|"GO:translation"|PF00203|IPR002222| RP:SCP:NREP 1 RP:SCP:REP 2->85|1fjgS|2e-31|66.7|84/84|d.28.1.1| HM:SCP:REP 2->85|1fjgS_|6e-32|56.0|84/84|d.28.1.1|1/1|Ribosomal protein S19| OP:NHOMO 1000 OP:NHOMOORG 984 OP:PATTERN --1-11---------------11------1--------------------1-------------1--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11---1-1-1-----1-1111111-111111----111-1-1----111111-1111-1111-1111111111111-111--1411111-1111--------------------------------------------------------------------1111--------1-9112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 100.0 SQ:SECSTR ccccccccccccHHHHHHHHTTTTTTccccEEEccccccccTTcTTccEEEEccccEEEEcccccccccccTTTcccccccccccccccccc DISOP:02AL 1-1,21-27,80-93| PSIPRED ccccccccccccHHHHHHHHHHHcccccccEEEEEEcEEEcHHHcccEEEEEcccEEEEEEEccccEEcccccccccccccccccccccccc //