[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53586.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL29_CORGL   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  251/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->68 1r73A PDBj 1e-10 45.2 %
:RPS:PDB   7->66 3bboZ PDBj 3e-15 35.0 %
:RPS:SCOP  7->67 1vs6X1  a.2.2.1 * 5e-15 44.3 %
:HMM:SCOP  5->70 1r73A_ a.2.2.1 * 2.9e-19 62.1 %
:RPS:PFM   9->64 PF00831 * Ribosomal_L29 4e-09 64.3 %
:HMM:PFM   8->64 PF00831 * Ribosomal_L29 1.6e-27 57.9 57/58  
:BLT:SWISS 1->76 RL29_CORGL 1e-38 100.0 %
:PROS 43->57|PS00579|RIBOSOMAL_L29

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53586.1 GT:GENE BAF53586.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 680406..680636 GB:FROM 680406 GB:TO 680636 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53586.1 LENGTH 76 SQ:AASEQ MAIGTPAHEFRELNEEELVTRLNEAKEELFNLRFQLATGQLTNNRRLRTVKRDIARIYTVIRERELGLSVVPGAEA GT:EXON 1|1-76:0| SW:ID RL29_CORGL SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=Cgl0516, cg0603; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->76|RL29_CORGL|1e-38|100.0|76/76| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 43->57|PS00579|RIBOSOMAL_L29|PDOC00501| BL:PDB:NREP 1 BL:PDB:REP 7->68|1r73A|1e-10|45.2|62/66| RP:PDB:NREP 1 RP:PDB:REP 7->66|3bboZ|3e-15|35.0|60/65| RP:PFM:NREP 1 RP:PFM:REP 9->64|PF00831|4e-09|64.3|56/58|Ribosomal_L29| HM:PFM:NREP 1 HM:PFM:REP 8->64|PF00831|1.6e-27|57.9|57/58|Ribosomal_L29| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00831|IPR001854| GO:PFM GO:0005622|"GO:intracellular"|PF00831|IPR001854| GO:PFM GO:0005840|"GO:ribosome"|PF00831|IPR001854| GO:PFM GO:0006412|"GO:translation"|PF00831|IPR001854| RP:SCP:NREP 1 RP:SCP:REP 7->67|1vs6X1|5e-15|44.3|61/63|a.2.2.1| HM:SCP:REP 5->70|1r73A_|2.9e-19|62.1|66/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 251 OP:NHOMOORG 251 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-11111111111111111111111111111111111111111111111111111111111111------------------------------------------------------11111111--------------------------------------------11-11111111111111111111111111111111111111111111111111111111111111111111111111111111-1111----------1--11111111111-------------1---------11111111111111111111111----11--111111111111111------------------------1-----------------------------------------11--1--------1---------------1-----------------------------------------------------------------------------------------------------------11--11--11111----111-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1---1---------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 85.5 SQ:SECSTR ###ccHHHHHHHccHHHHHHHHHHHTTHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHT######## DISOP:02AL 1-3,35-47,66-77| PSIPRED ccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //