[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53591.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL14_CORGL   RecName: Full=50S ribosomal protein L14;

Homologs  Archaea  67/68 : Bacteria  909/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
b.39.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->121 3i1nK PDBj 3e-43 65.3 %
:RPS:PDB   1->122 3bboM PDBj 8e-49 59.5 %
:RPS:SCOP  1->122 1s72K  b.39.1.1 * 3e-44 40.7 %
:HMM:SCOP  1->122 1whiA_ b.39.1.1 * 4.4e-52 63.1 %
:RPS:PFM   1->122 PF00238 * Ribosomal_L14 1e-41 71.3 %
:HMM:PFM   1->122 PF00238 * Ribosomal_L14 4.2e-56 63.1 122/122  
:BLT:SWISS 1->122 RL14_CORGL 1e-64 100.0 %
:PROS 60->86|PS00049|RIBOSOMAL_L14

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53591.1 GT:GENE BAF53591.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 682407..682775 GB:FROM 682407 GB:TO 682775 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53591.1 LENGTH 122 SQ:AASEQ MIQQESRLKVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKEATPGGNVKSGEIVKAVIVRTKKETRRADGSYISFDENAAVIIKNDNEPRGTRIFGPVARELREKKFMKIVSLAPEVI GT:EXON 1|1-122:0| SW:ID RL14_CORGL SW:DE RecName: Full=50S ribosomal protein L14; SW:GN Name=rplN; OrderedLocusNames=Cgl0521, cg0608; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RL14_CORGL|1e-64|100.0|122/122| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 60->86|PS00049|RIBOSOMAL_L14|PDOC00048| BL:PDB:NREP 1 BL:PDB:REP 1->121|3i1nK|3e-43|65.3|121/122| RP:PDB:NREP 1 RP:PDB:REP 1->122|3bboM|8e-49|59.5|121/121| RP:PFM:NREP 1 RP:PFM:REP 1->122|PF00238|1e-41|71.3|122/122|Ribosomal_L14| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF00238|4.2e-56|63.1|122/122|Ribosomal_L14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00238|IPR000218| GO:PFM GO:0005622|"GO:intracellular"|PF00238|IPR000218| GO:PFM GO:0005840|"GO:ribosome"|PF00238|IPR000218| GO:PFM GO:0006412|"GO:translation"|PF00238|IPR000218| RP:SCP:NREP 1 RP:SCP:REP 1->122|1s72K|3e-44|40.7|118/132|b.39.1.1| HM:SCP:REP 1->122|1whiA_|4.4e-52|63.1|122/122|b.39.1.1|1/1|Ribosomal protein L14| OP:NHOMO 1355 OP:NHOMOORG 1158 OP:PATTERN 11111111111111111-11111111111111111111111111111111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22111111522-2222222122212222222222222212222222222122222222221221222212232223333322222233-2422222222222233511112111111---121114-1-251-213--1-1--1-1111---111111124112111113111123241H1112286892631111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEcccccEEEEEEEEEccccccccccTTcEEEEEEEEEccccccccccEEEEEEEEccccEEcTTccEEcccccEEEEccTTcccccccccccccGGGTTGTcHHHHHHccccc PSIPRED ccccccEEEEEEccccEEEEEEEEEccccccccccccEEEEEEEEEcccccEEEEEEEEEEEEEcccccccccccEEEEcccEEEEEcccccEEEEEEEcHHHHHHHHccccEEEEcccccc //