[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53614.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  481/915 : Eukaryota  30/199 : Viruses  1/175   --->[See Alignment]
f.38.1
:450 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   97->246 2d33D PDBj 7e-06 7.4 %
:RPS:SCOP  28->416 1pw4A  f.38.1.1 * 1e-05 11.5 %
:HMM:SCOP  5->450 1pw4A_ f.38.1.1 * 2.6e-70 27.8 %
:RPS:PFM   81->213 PF00083 * Sugar_tr 7e-09 37.5 %
:HMM:PFM   38->383 PF07690 * MFS_1 7.3e-30 25.5 318/353  
:BLT:SWISS 21->408 Y281_HAEIN 1e-58 38.4 %
:PROS 315->331|PS00216|SUGAR_TRANSPORT_1
:PROS 145->170|PS00217|SUGAR_TRANSPORT_2
:PROS 360->385|PS00217|SUGAR_TRANSPORT_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53614.1 GT:GENE BAF53614.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(701193..702545) GB:FROM 701193 GB:TO 702545 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53614.1 LENGTH 450 SQ:AASEQ MTNDMLATGHREIHIETKKSSDSLSNEHKRVLGGAMVGTTIEWFDFFIYAQAAGLIFATQYFNPATNQSPSLAQIIAWASLGISFLFRPVGAIIAGHLGDKLGRKPVLVLTLLGMGGATFAMGLLPNYAAIGIAAPILLVLLRILQGLSAGGEWGGAALIAVEHAPTNKRGYFGAFPQVGVPAGMALATIFMLIVTTALSPEQFETWGWRIPFLSSLLLIGIGFWIRSLVEESPVFAEMNDLKKTASAPLSTLFKQHSKLVILCALIFAGCNAAGYLAIAFFASYGTSVLKMDRPVVLALTLLTALAWIVATLVAGKVSDVIGRKQTFVIGYAAMIIWAIPTWLLIDTGNVLLFGIGVIVLGLFLGITYGPQPSLYAEMFPASVRLSGLSIGYALGSIIGGAFAPMIAELILDTTGNSINIGIYIAIISAISLIAVLMVPKGIQGKSLHD GT:EXON 1|1-450:0| BL:SWS:NREP 1 BL:SWS:REP 21->408|Y281_HAEIN|1e-58|38.4|385/438| PROS 315->331|PS00216|SUGAR_TRANSPORT_1|PDOC00190| PROS 145->170|PS00217|SUGAR_TRANSPORT_2|PDOC00190| PROS 360->385|PS00217|SUGAR_TRANSPORT_2|PDOC00190| TM:NTM 12 TM:REGION 31->53| TM:REGION 74->96| TM:REGION 117->139| TM:REGION 142->164| TM:REGION 176->198| TM:REGION 207->229| TM:REGION 256->278| TM:REGION 293->315| TM:REGION 326->347| TM:REGION 353->369| TM:REGION 386->408| TM:REGION 420->442| SEG 138->148|llvllrilqgl| SEG 296->315|vvlaltlltalawivatlva| SEG 351->367|vllfgigvivlglflgi| SEG 418->435|sinigiyiaiisaislia| RP:PDB:NREP 1 RP:PDB:REP 97->246|2d33D|7e-06|7.4|135/499| RP:PFM:NREP 1 RP:PFM:REP 81->213|PF00083|7e-09|37.5|120/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 38->383|PF07690|7.3e-30|25.5|318/353|MFS_1| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 28->416|1pw4A|1e-05|11.5|366/434|f.38.1.1| HM:SCP:REP 5->450|1pw4A_|2.6e-70|27.8|414/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2822 OP:NHOMOORG 531 OP:PATTERN ------4867996684-623322--------------------------------------113---- 111-131577C-2154433-37--2U3333325999DNno--224-1--441PJL726-----438Q77311111222-13-A--111--------1--1-2---2-2-2-----------------1-1---1-------11111--------------121---------1-----1-----1--------1222222211222222------222-23--1-------1-1111111111111111-112----11-2-----11-----11--------------------------------------------------------------------------------------------------1--44461442452G551-32323244444443435-66A55I7C221-666622344544B4-----5-----1-32333333355121-1442334441132457A64E4464463233-1564-63345XOOVQTCFIIDUUaMKMKICIWJYAIDB-5FC832522611-8336---1141-------11--1-1--1----21--------------111111-----1-5455341-2222212-------1-1---------------1--------------1---------8778287677A788866-777678867778877677778766--29989799997879798944754551-433333333333----11111575711-11-------22211--188889571125-AAC9CEE91FGGG-B9A944339444----------1----55545444441111---------------------------------------------------------1- ------------------------------------------------1--------1-1111--------------------------121-124---11--122--6------------------------------------------------------3------------11-----1---11-21231---1 --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 135 STR:RPRED 30.0 SQ:SECSTR ################################################################################################TTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTE########EccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEE#######EEccTTcTTcccHHHHHHHHHHHHHHHHcccccccHHHHHHTHH############################################################################################################################################################################################################ DISOP:02AL 1-27,236-250,443-451| PSIPRED ccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHcccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccc //