[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53623.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  605/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->261 3h81A PDBj 4e-27 32.5 %
:RPS:PDB   3->260 1dubA PDBj 1e-40 27.2 %
:RPS:SCOP  3->258 1dubA  c.14.1.3 * 1e-43 27.4 %
:HMM:SCOP  3->258 2fw2A1 c.14.1.3 * 3.9e-60 33.5 %
:RPS:PFM   16->182 PF00378 * ECH 1e-24 38.3 %
:HMM:PFM   16->183 PF00378 * ECH 2.4e-33 32.1 168/170  
:BLT:SWISS 18->261 ECHA8_MYCTU 1e-26 32.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53623.1 GT:GENE BAF53623.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 709580..710365 GB:FROM 709580 GB:TO 710365 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53623.1 LENGTH 261 SQ:AASEQ MIDLNIHRIDEHASYAEVVLNDPSTLNAIAEQDLLDISAAYTEAEKAGVRALLLRGEGKGFCSGRNIKGVVPAEDDAADYLANKVTPVLKQMSAFPAPTFAAVHGACLGVGLGLAIASDIVYVAEKSKFGSPFANLGATLDSGGHALFVERLGAHRTMDLIVTGELISGAEAVNSGLFSRLVPTEELLDFTRDKVIRAAQGATQAFVTSKALVQDIRDNCTGLWDSVAVENEEQGRLCSSTDYAEGFAAFNEKRTPVFFGR GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 18->261|ECHA8_MYCTU|1e-26|32.5|240/257| BL:PDB:NREP 1 BL:PDB:REP 18->261|3h81A|4e-27|32.5|240/256| RP:PDB:NREP 1 RP:PDB:REP 3->260|1dubA|1e-40|27.2|254/260| RP:PFM:NREP 1 RP:PFM:REP 16->182|PF00378|1e-24|38.3|167/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 16->183|PF00378|2.4e-33|32.1|168/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 3->258|1dubA|1e-43|27.4|252/260|c.14.1.3| HM:SCP:REP 3->258|2fw2A1|3.9e-60|33.5|254/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 3878 OP:NHOMOORG 808 OP:PATTERN 22-1--4976777766-121111852231227-----------------------------1331-11 2341A213--2332ESJAA-AF11HP99999FPJOJCQbZ-F4E--14----543333--78C-7887584--------1318-----1111-1211--2-111143211--------------11111121111134432---4611-1--1-111--------1-1111------------33323---5544444444555444443555445545AA65411111119-111111111111111111111-------------------11-111---1111111111-1111111111111111111111-1111111--1331111111212-2221221-2-1-3-11-341427-15---1--2-3--A66B--1--3-QFI324LDICB34433442443-1-5-1E2778L-533-22575688687C4778356577C--------511-1A63-----------------------------1AFP9-3SJBK7798K854443888A555425A6PEUTO23CB573587E5EEGK118----54----------G883Q871----------6762B12--34237333---------------------------341451615434333343433343355445---2-1-------42231226443633366-466643364643444644544422323454444444444444442334444--333333333333---1111111111-4622111111111112111BBA9B363522166666545276777333----------1--2-----343432242322444-------1664433------------------------------------------------1 ----545-321-3347754978675744545345533855555434354497A9552121113-----------1------12-11-1-2427435121-212788-673F8676A56433691E6372KsD-K6D4162723671457-63293454B9A439752636C98642111L21123723C3532433423 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 99.2 SQ:SECSTR ##cEEEEEEcGGGcEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHTTccEEEEEccccEEEccccHHHHHHTTccHHHHHHTTTTTTTTGGGGccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcTTTHHHHHHHHHHHHHHccHHHHHHHHHHHHGGGTccccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTTcccccccH DISOP:02AL 1-2,258-262| PSIPRED ccccEEEEEEEEccEEEEEEccHHHHccccHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccc //