[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53627.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  269/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:133 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->130 1o0iA PDBj 3e-16 36.6 %
:RPS:PDB   17->130 2b6eA PDBj 8e-13 35.1 %
:RPS:SCOP  13->132 1q4sA  d.38.1.5 * 7e-15 31.7 %
:HMM:SCOP  3->129 1zkiA1 d.38.1.5 * 5.3e-23 32.0 %
:HMM:PFM   43->119 PF03061 * 4HBT 2.2e-13 30.3 76/79  
:BLT:SWISS 3->129 Y1618_PSEAE 1e-17 37.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53627.1 GT:GENE BAF53627.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(713278..713679) GB:FROM 713278 GB:TO 713679 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53627.1 LENGTH 133 SQ:AASEQ MEQELWTIQLGELDKKMGVEVLEQSANKVVARMPIDGNRQSLGLLHGGAMVSLAEAVGSWAAVIHASSMGKVAVGVDINATHHASGLKGYVTATATAIRLGRTLTSHEVVLHDDAGKRLCTARITNAIVDKRA GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 3->129|Y1618_PSEAE|1e-17|37.8|127/145| BL:PDB:NREP 1 BL:PDB:REP 17->130|1o0iA|3e-16|36.6|112/135| RP:PDB:NREP 1 RP:PDB:REP 17->130|2b6eA|8e-13|35.1|111/134| HM:PFM:NREP 1 HM:PFM:REP 43->119|PF03061|2.2e-13|30.3|76/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 13->132|1q4sA|7e-15|31.7|120/142|d.38.1.5| HM:SCP:REP 3->129|1zkiA1|5.3e-23|32.0|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 331 OP:NHOMOORG 271 OP:PATTERN -------------------------------------------------------------------- ----1--1--1------------------------------1-1-1111111122112----111111111-----------------111--1111--1-111--111----------------11111111111---11---1--------------------------------------21111---1-1111111111111111--1111111111----111111--------------------11--------------------------------------------------------------------------------------------------1---------1------------------------------------------------------------------------1------------------------------------------------------------11-------------------------------------------1111-1111----------------11---1--1--------------------1-----------------------------------111-1----111111111111111111111-------------222211-2222222222-223221222222222222222111111222222222222222212221122--111111111111----11111------------111-11111111------------1111-1111----1111----------111111111111111111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 99.2 SQ:SECSTR #HHHHHHHTTTcHHHHTTcEEEEEcEccccEEEEEcTTTcTTccccHHHHHHHHHHHHHHHHHHTccHTTcEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEcTTccEEEEEEEEEEEEcHHc DISOP:02AL 1-3,133-134| PSIPRED ccHHHHHHcccHHHHHcccEEEEEEccEEEEEEEEccHHccccEEHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEEEEEEEEEccc //