[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53632.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  689/915 : Eukaryota  153/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:422 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->414 1q1wA PDBj 4e-68 35.8 %
:RPS:PDB   9->414 1d7yA PDBj 4e-47 32.0 %
:RPS:SCOP  9->115 1h6vA2  c.3.1.5 * 2e-04 16.4 %
:RPS:SCOP  117->248 1xhcA2  c.3.1.5 * 8e-22 27.9 %
:RPS:SCOP  324->415 1q1rA3  d.87.1.1 * 3e-25 33.7 %
:HMM:SCOP  1->199 1gv4A1 c.3.1.5 * 3.9e-40 33.7 %
:HMM:SCOP  151->322 1d7yA1 c.3.1.5 * 1.1e-31 35.8 %
:HMM:SCOP  323->419 1q1rA3 d.87.1.1 * 4.2e-27 39.2 %
:RPS:PFM   9->285 PF07992 * Pyr_redox_2 5e-14 34.1 %
:HMM:PFM   9->288 PF07992 * Pyr_redox_2 2.2e-36 32.1 196/202  
:BLT:SWISS 9->412 THCD_RHOER 5e-76 40.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53632.1 GT:GENE BAF53632.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(718735..720003) GB:FROM 718735 GB:TO 720003 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53632.1 LENGTH 422 SQ:AASEQ MNTSAETGILIIGANQSGVQLAISLRATGFTESITLLGEEDHRPYQRPALSKEFLQDKIDKERLIFRSNEYWEENNIRLVKGVRIERIEKNDDGSGVAYGAGQEFAFRRLALAVGARPRHLDLPGATFEGVTYLRNADDALALKAMIGSVTDAVVVGGGFIGLEAACSLHDLGKNVTVLEYGPRLIGRAVGEETAAFFLEQHRSRGVNIVLDARMKQFVGKDGKLSGVELEDGTVIPAQLVIVGIGVIPNTELATDLGLDINNGIVVDKHAVASDGTTIAIGDVANIPNPIPGSPADERIRLESVNNAIEHAKIAAYSLVGQPEAYAGIPWFWSNQGDLKLQIAGLTVGYDSTVIRQDPEKKKFSVLYYRGDNIIAADCVNAPLDFMAVRSALSKNQNIPADLAADISQPLKKLAVDLEVTR GT:EXON 1|1-422:0| BL:SWS:NREP 1 BL:SWS:REP 9->412|THCD_RHOER|5e-76|40.7|398/427| BL:PDB:NREP 1 BL:PDB:REP 4->414|1q1wA|4e-68|35.8|405/422| RP:PDB:NREP 1 RP:PDB:REP 9->414|1d7yA|4e-47|32.0|391/401| RP:PFM:NREP 1 RP:PFM:REP 9->285|PF07992|5e-14|34.1|264/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 9->288|PF07992|2.2e-36|32.1|196/202|Pyr_redox_2| RP:SCP:NREP 3 RP:SCP:REP 9->115|1h6vA2|2e-04|16.4|91/122|c.3.1.5| RP:SCP:REP 117->248|1xhcA2|8e-22|27.9|122/122|c.3.1.5| RP:SCP:REP 324->415|1q1rA3|3e-25|33.7|92/103|d.87.1.1| HM:SCP:REP 1->199|1gv4A1|3.9e-40|33.7|196/0|c.3.1.5|1/2|FAD/NAD(P)-binding domain| HM:SCP:REP 151->322|1d7yA1|1.1e-31|35.8|165/184|c.3.1.5|2/2|FAD/NAD(P)-binding domain| HM:SCP:REP 323->419|1q1rA3|4.2e-27|39.2|97/103|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 2451 OP:NHOMOORG 894 OP:PATTERN --12-12211122212121112152111222221111111111--------2-22422443-122--- -14251-222211162244-47--44444441778759HJ32322121212-537-1-1132921487443-1111111--2122---3321-322-----2-1-231-----------------11-111112-211111111211----------111------1-----1111--1-1--3211132-14455555534354655464444354425222451----11443333333333333323342223-44-311178224542323243344421222221111-1111111122122121122233---333351216333233133224221333422211-11144322322243326113--28443-----554334522222233333233332-33333655252-422456945667164212451111211--------22121722------------11---1111-1-------246424432567889745555884866661585A38732344356245444464445232212-------232642256222112332211-3--3437211312413------------------------1225334622-2121122133211112131142--1-2-1------42331414443433344-445443334443434444354433111233322322233333333333334---11111111111---1-11------36243---------------76747241423133343253343545444111--1--132122-----3-555--13333---1111111344----1---11--21211112-2-211--111131111---111123-33321- 11--112-1---22211221212111111111111111111111112111223611222111------------------------11-12211111111211111-2-235A349-221122256-4-8E4-426121-21132-221-11-31343326412221923421222222Q11112468628322----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 417 STR:RPRED 98.8 SQ:SECSTR ccccHHTTEEEEcccHHHHHHHHHHHHHTccccEEEEEcccccccccGGGGTTHHHHccGGGccccHHHHGGGcTTcEEEETcTccEEEEETTTTEEEETTccEEEccEEEEcccEEEcccGGGTTccccEEEcccHHHHHHHHHHccTTcEEEEEcccHHHHHHHHHHHHTTcEEEEEEccccTTTTTccHHHHHHHHHHHHTTTcEEEEcccEEEEETTEEEEEEEEETTccEEEccEEEEcccEEEccHHHHHTTccccccEEccTTcccccTTEEEcGGGEEEEcTTTcccTTcEEEcccHHHHHHHHHHHHHHHHcTTcccccccEEEEEETTEEEEEEEcccccEEEEEEccccccEEEEEEEETTEEEEEEEEccHHHHHHHHHHHHTTccccHHHHHccccHHHHHHHH##### DISOP:02AL 1-5,422-423| PSIPRED ccccccccEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHcccccHHHHHcccHHHHHHcccEEEEccEEEEEEccccEEEEEEccccEEEccEEEEEcccEEccccccccccccEEEEccHHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEccccEEEEEEccccEEEccEEEEEccEEEcHHHHHHccccccccEEEccccccccccEEEccccccccccccccccccEEEEccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEEcccccEEEEEcccccccEEEEEEEccEEEEEEEEccHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHcccc //