[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53636.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  417/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
d.142.1
:364 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->337 2olsA PDBj 4e-47 41.0 %
:RPS:PDB   9->310 1dikA PDBj 6e-47 25.1 %
:RPS:SCOP  9->329 1dikA3  d.142.1.5 * 2e-55 29.3 %
:HMM:SCOP  1->333 1h6zA3 d.142.1.5 * 4.3e-93 43.9 %
:RPS:PFM   22->327 PF01326 * PPDK_N 4e-55 43.5 %
:HMM:PFM   23->341 PF01326 * PPDK_N 4.3e-103 42.1 309/329  
:BLT:SWISS 7->329 PPSA_METTH 1e-74 48.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53636.1 GT:GENE BAF53636.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(723047..724141) GB:FROM 723047 GB:TO 724141 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53636.1 LENGTH 364 SQ:AASEQ MTNSLNIPFVQRFDEGLDPVLEVLGGKGASLVTMTDAGMPVPPGFVVTTASFDEFIREAGVAEHIDKFLNDLDAEDVKEVDRVSAIIRDELCSLEVPENARFAVHQAYRDLMERCGGDVPVAVRSSATAEDLPDASFAGQQDTYLWQVGLSAVTEHIRKCWASLFTSRAIIYRLKNNIPNEGLSMAVVVQKMVNSRVAGVAITMNPSNGDRSKITIDSSWGVGEMVVSGEVTPDNILLDKITLQVVSEHIGSKHAELIPDATSGSLVEKPVDEERANRRSLTDEEMFAVAQMAKRAEKHYKCPQDIEWALDADLPDGENLLLLQSRPETIHSNGVKKETPTPQAAKTIGTFDFSSITVAMTGTK GT:EXON 1|1-364:0| BL:SWS:NREP 1 BL:SWS:REP 7->329|PPSA_METTH|1e-74|48.7|314/684| BL:PDB:NREP 1 BL:PDB:REP 21->337|2olsA|4e-47|41.0|307/725| RP:PDB:NREP 1 RP:PDB:REP 9->310|1dikA|6e-47|25.1|299/869| RP:PFM:NREP 1 RP:PFM:REP 22->327|PF01326|4e-55|43.5|292/315|PPDK_N| HM:PFM:NREP 1 HM:PFM:REP 23->341|PF01326|4.3e-103|42.1|309/329|PPDK_N| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF01326|IPR002192| GO:PFM GO:0016301|"GO:kinase activity"|PF01326|IPR002192| GO:PFM GO:0016310|"GO:phosphorylation"|PF01326|IPR002192| RP:SCP:NREP 1 RP:SCP:REP 9->329|1dikA3|2e-55|29.3|276/375|d.142.1.5| HM:SCP:REP 1->333|1h6zA3|4.3e-93|43.9|310/0|d.142.1.5|1/1|Glutathione synthetase ATP-binding domain-like| OP:NHOMO 741 OP:NHOMOORG 512 OP:PATTERN 32111-21222222221-12111111111-211111111111122111113311111111211----- -------1111----------2--11------3111-1----21-1-1----246-----211---4-11------------211111-----------------2-111-------------------------------1111233322231111------11114432------------11211-----311111111-111111--3312111-------11111-11-------------------------------11-------------111----1--------------------------1--------1-2-351111111-1-1133-------------144411-11----------1----2-------112-------------------------------------------------------------------------1------------------------------------111111111111111122121111111111211-13311112112212111-11111111111112123211162-4723445561-1--21121--1-1414-----------111111111-11111111211-1121-1111111111-11111111--11111------11111111111111111-1111111111111111111111112211111111111111111111111111-111111111111---1-----1111-1311---------------11111111111-11111111111111132---------1---1111111111111111111111111------------------1-------------------------------------2-- -------------------11-1---1----------------------111-C---11------------------------------------------------12-2----------------------------------------------------2-21----11--1--1X222213235-32-11---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 330 STR:RPRED 90.7 SQ:SECSTR ########cEEEcTTccGGGHHHHHHHHHHHHHHHHHTcccccEEEEccHHHHHHHTTHHHHHHHHHHHHHHHHHTTcEEEEEEccccTTTccEEEEccHHHHHHHHHHHHHHHHHTTTTcccGGGccHHHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHTTcHHHHHHHHHTTccTTcccEEEEEEEcccccEEEEEEEEcTTTccEEEEEEEEEcccHHHHTccccccEETTTHHHHcHHHHHHHHHHHHHHHHHTHHTcccEEEEEEETTEEEEEEcccccccHHHHHHHHHHHHHTTccHHHHHT##HHHTTcccHHHHHHTccGGGGGGGGc######################## DISOP:02AL 1-6,8-8,333-334,336-340,363-365| PSIPRED ccccccccEEEEHHHccHHHHHHHccccccHHHHHHccccccccEEEcHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEcccccHHccccccccccccEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccEEEEEEEEEEcccEEEEEEEcccccccccEEEEEEcccccccEEccEEcccEEEEEcccHHHHHHHcccHHHHHHcccccccEEEEEccHHHHccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccEEEEEEEccEEEEccccccccccHHHHHHccHHHHHcHHHHccccc //